Recombinant Full Length Methanocaldococcus Jannaschii Phosphate-Binding Protein Psts(Psts) Protein, His-Tagged
Cat.No. : | RFL8905MF |
Product Overview : | Recombinant Full Length Methanocaldococcus jannaschii Phosphate-binding protein pstS(pstS) Protein (Q58421) (1-389aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanocaldococcus jannaschii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-389) |
Form : | Lyophilized powder |
AA Sequence : | MNDTTQPTKGDAVKKILALILGLCLIVPVISIAGCVGGGNSQPSNNEKPSTIIIRTTGAT FPKYQIQKWIEDYQKTHPNVKIEYEGGGSGYGQEAFAKGLTDIGRTDPPVKESMWKKFLS TGDQPLQFPEIVGAVVVTYNIPEIGDKTLKLSRDVLADIFLGKIEYWDDERIKKINPEIA DKLPHEKIIVVHRSDASGTTAIFTTYLSLISKEWAEKVGAGKTVNWPTDNIGRGVAGKGN PGVVAIVKSTPYTVAYTELSYAIEQKLPVAALENKNGKFVKPTDETIKAAVSAVKASIPN PTEGYKEDLKQMLDAPGDNAYPIVAFTHLLVWENKNGKHYSPEKAKAIKDFLTWVLTEGQ KPEHLAPGYVGLPEDVAKIGLNAVNMIKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pstS |
Synonyms | pstS; MJ1015; Phosphate-binding protein PstS; PBP |
UniProt ID | Q58421 |
◆ Recombinant Proteins | ||
Fam234a-304M | Recombinant Mouse Fam234a Protein, MYC/DDK-tagged | +Inquiry |
PDAP1-3981H | Recombinant Human PDAP1 Protein (Met1-Lys181), N-His tagged | +Inquiry |
XRCC1-596H | Recombinant Human XRCC1 Protein, His-tagged | +Inquiry |
RFL19370HF | Recombinant Full Length Human Vomeronasal Type-1 Receptor 1(Vn1R1) Protein, His-Tagged | +Inquiry |
CRP-7771C | Recombinant Cattle CRP protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
GG-192M | Native Mouse Gamma Globulin protein | +Inquiry |
Mucin-313 | Native Porcine Mucin Type III protein | +Inquiry |
Hb-117M | Native Mouse Hb | +Inquiry |
Collagen-57H | Native Human Collagen Type II | +Inquiry |
C4A-158H | Native Human C4A protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1R8-2932HCL | Recombinant Human PPP1R8 293 Cell Lysate | +Inquiry |
SkeletalMuscles-470C | Cat Skeletal Muscles Lysate, Total Protein | +Inquiry |
TFB1M-1136HCL | Recombinant Human TFB1M 293 Cell Lysate | +Inquiry |
PCDHGC5-3383HCL | Recombinant Human PCDHGC5 293 Cell Lysate | +Inquiry |
DDIT4-7026HCL | Recombinant Human DDIT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pstS Products
Required fields are marked with *
My Review for All pstS Products
Required fields are marked with *
0
Inquiry Basket