Recombinant Full Length Mesocricetus Auratus Gap Junction Gamma-1 Protein(Gjc1) Protein, His-Tagged
Cat.No. : | RFL35051MF |
Product Overview : | Recombinant Full Length Mesocricetus auratus Gap junction gamma-1 protein(GJC1) Protein (Q6PYT3) (1-396aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mesocricetus auratus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-396) |
Form : | Lyophilized powder |
AA Sequence : | MSWSFLTRLLEEIHNHSTFVGKIWLTVLIVFRIVLTAVGGESIYYDEQSKFVCNTEQPGC ENVCYDAFAPLSHVRFWVFQIILVATPSVMYLGYAIHKIAKMEHGEADKKAARSKPYAMR WKQHRALEETEEDHEEDPMMYPEMELESEKENKEQSQPKPKHDGRRRIREDGLMKIYVLQ LLARTVFEVGFLIGQYFLYGFQVHPFYVCSRLPCPHKIDCFISRPTEKTIFLLIMYGVTG LCLLLNIWEMLHLGFGTIRDSLNSKRRELDDPGAYNYPFTWNTPSAPPGYNIAVKPDQIQ YTELSNAKIAYKQNKANIAQEQQYGSHEEHLPADLETLQREIRMAQERLDLAIQAYHHQN NPHGPREKKAKVGSKSGSNKSSISSKSGDGKTSVWI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GJC1 |
Synonyms | GJC1; GJA7; Gap junction gamma-1 protein; Connexin-45; Cx45; Gap junction alpha-7 protein |
UniProt ID | Q6PYT3 |
◆ Recombinant Proteins | ||
NFE2-1276H | Recombinant Human NFE2, GST-tagged | +Inquiry |
JAG2-1869H | Recombinant Human JAG2 protein, His-tagged | +Inquiry |
RFL12283MF | Recombinant Full Length Mouse Androgen-Induced Gene 1 Protein(Aig1) Protein, His-Tagged | +Inquiry |
SCUA-0075B | Recombinant Bacillus subtilis SCUA protein, His-tagged | +Inquiry |
NAIF1-2942R | Recombinant Rhesus monkey NAIF1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FSH-185H | Active Native Human Follicle Stimulating Hormone(FSH) protein | +Inquiry |
TF-71R | Native Rat Apotransferrin | +Inquiry |
Lectin-1764C | Active Native Succinylated Canavalia ensiformis Concanavalin A Protein, Biotinylated | +Inquiry |
DI-24 | Active Native Diaphorase (NADH) | +Inquiry |
TNNC1-25H | Native Human TNNC1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALCOCO1-7894HCL | Recombinant Human CALCOCO1 293 Cell Lysate | +Inquiry |
HIST1H1C-5553HCL | Recombinant Human HIST1H1C 293 Cell Lysate | +Inquiry |
RNPS1-2258HCL | Recombinant Human RNPS1 293 Cell Lysate | +Inquiry |
CDK5RAP1-7624HCL | Recombinant Human CDK5RAP1 293 Cell Lysate | +Inquiry |
CPB2-2252HCL | Recombinant Human CPB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GJC1 Products
Required fields are marked with *
My Review for All GJC1 Products
Required fields are marked with *
0
Inquiry Basket