Recombinant Full Length Mentha Piperita Cytochrome P450 71A8(Cyp71A8) Protein, His-Tagged
Cat.No. : | RFL31730MF |
Product Overview : | Recombinant Full Length Mentha piperita Cytochrome P450 71A8(CYP71A8) Protein (Q42716) (1-502aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mentha piperita (Peppermint) (Mentha aquatica x Mentha spicata) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-502) |
Form : | Lyophilized powder |
AA Sequence : | MYSIAFMLVLRKMDEIISHTLAFQALVSLILLISITKWLSNSPKNKNSSPPSPRKLPILG NLLQLGSLPHHNLRSMARKHGPIMLLHLGSVRPVSSRRRPRGNHENSRSRLRRPRGSRSA ALQLQGRVGGYGEYWRQLKTICVVQLLSNKRVQSFRSVREEETELLMKKIGDSSGNVNLS HMFTQLTNDVVCRSAIGRKYGAGDENGEKFLEILREFLELLGAISIGDFVPSLWWINRIN GFDRRVDRIAKEMDEFLEKVIHERLENPAAKAEENFVDILLEIYRNNSAGVSIDRDSIKA IILDVFAAGTDTTAVVLEWAMTELLRHPEIMKKLQSEVRQVVKDKHNITDDDIEKMHYLK AVMKETMRFHTPIPLLVPRVARNDVEVMGYDVPVGTMVMINAWAIGRDPTSWDEPEKFRP ERFLNSSVDFKGLDFELIPFGAGRRGCPGTTFPMATLEFTLANLMQKFDWELPHECRELD MSERPGVAIRRVIPLLAIGTKM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYP71A8 |
Synonyms | CYP71A8; Cytochrome P450 71A8 |
UniProt ID | Q42716 |
◆ Recombinant Proteins | ||
CYP2AA3-9828Z | Recombinant Zebrafish CYP2AA3 | +Inquiry |
DEFA6-26996TH | Recombinant Human DEFA6 | +Inquiry |
RFL5600NF | Recombinant Full Length Nycticeius Humeralis Cytochrome B(Mt-Cyb) Protein, His-Tagged | +Inquiry |
FAM198B-3730H | Recombinant Human FAM198B Protein, GST-tagged | +Inquiry |
RFL36473KF | Recombinant Full Length Koribacter Versatilis Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IgA-248A | Native Alpaca Immunoglobulin A | +Inquiry |
ORM1-26392TH | Native Human ORM1 | +Inquiry |
FGG -57R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
FGA-34D | Native Canine Fibrinogen | +Inquiry |
BOD-38 | Active Native Bilirubin oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
RG9MTD1-2392HCL | Recombinant Human RG9MTD1 293 Cell Lysate | +Inquiry |
LGALS7B-4764HCL | Recombinant Human LGALS7B 293 Cell Lysate | +Inquiry |
UMPS-503HCL | Recombinant Human UMPS 293 Cell Lysate | +Inquiry |
SEPT10-1966HCL | Recombinant Human SEPT10 293 Cell Lysate | +Inquiry |
HMOX2-5466HCL | Recombinant Human HMOX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP71A8 Products
Required fields are marked with *
My Review for All CYP71A8 Products
Required fields are marked with *
0
Inquiry Basket