Recombinant Full Length Mayaro Virus Structural Polyprotein Protein, His-Tagged
Cat.No. : | RFL23568MF |
Product Overview : | Recombinant Full Length Mayaro virus Structural polyprotein Protein (Q8QZ72) (807-1242aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mayaro Virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (807-1242) |
Form : | Lyophilized powder |
AA Sequence : | YEHTAIIPNQVGFPYKAHVAREGYSPLTLQMQVIETSLEPTLNLEYITCDYKTKVPSPYV KCCGTAECRTQDKPEYKCAVFTGVYPFMWGGAYCFCDSENTQMSEAYVERADVCKHDHAA AYRAHTASLRAKIKVTYGTVNQTVEAYVNGDHAVTIAGTKFIFGPVSTPWTPFDTKILVY KGELYNQDFPRYGAGQPGRFGDIQSRTLDSRDLYANTGLKLARPAAGNIHVPYTQTPSGF KTWQKDRDSPLNAKAPFGCIIQTNPVRAMNCAVGNIPVSMDIADSAFTRLTDAPVISELT CTVSTCTHSSDFGGIAVLSYKVEKSGRCDIHSHSNVAVLQEVSIETEGRSVIHFSTASAS PSFVVSVCSSRATCTAKCEPPKDHVVTYPANHNGVTLPDLSSTAMTWAQHLAGGVGLLIA LAVLILVIVTCVTLRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mayaro virus Structural polyprotein |
Synonyms | Structural polyprotein; p130 |
UniProt ID | Q8QZ72 |
◆ Recombinant Proteins | ||
RFL1017BF | Recombinant Full Length Burkholderia Mallei Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged | +Inquiry |
HK3-42H | Recombinant Human Hexokinase 3,His-tagged | +Inquiry |
YTLQ-3377B | Recombinant Bacillus subtilis YTLQ protein, His-tagged | +Inquiry |
SLC4A1-89HFL | Recombinant Full Length Human SLC4A1 Protein, C-Flag-tagged | +Inquiry |
PSMB6-2019H | Recombinant Human PSMB6, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1788G | Active Native Griffonia Simplicifolia Lectin II Protein, Biotinylated | +Inquiry |
Cry1Ab-523 | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
Serpinc1-298M | Active Native Mouse Antithrombin III | +Inquiry |
C1q-07R | Native Rat C1q Protein | +Inquiry |
PLAT-30946TH | Native Human PLAT | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK5R2-328HCL | Recombinant Human CDK5R2 cell lysate | +Inquiry |
ALS2CR11-8892HCL | Recombinant Human ALS2CR11 293 Cell Lysate | +Inquiry |
FGL2-622HCL | Recombinant Human FGL2 cell lysate | +Inquiry |
TSEN34-721HCL | Recombinant Human TSEN34 293 Cell Lysate | +Inquiry |
WDR20-353HCL | Recombinant Human WDR20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Mayaro virus Structural polyprotein Products
Required fields are marked with *
My Review for All Mayaro virus Structural polyprotein Products
Required fields are marked with *
0
Inquiry Basket