Recombinant Full Length Marinobacter Aquaeolei Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL15751MF |
Product Overview : | Recombinant Full Length Marinobacter aquaeolei ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (A1TZE0) (1-633aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Marinobacter hydrocarbonoclasticus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-633) |
Form : | Lyophilized powder |
AA Sequence : | MTPSNEPGKQDQIPQPGPTIPNQYSFLWLSAAIFLMFLWLQGNNQQQQQELAYSEFKQAV ISGQVAEVTLRTEEISGSFTDSGASRFANDSRPPSSSFITLRPQVEDPELLPLLERQEVL VRGSRSGRPWWQELILGFLPWILLLALMFWFWGAAQKRMTQGGGPFDYGKSRARRARRET STTTLDDVAGIESAKRDISEIIDFLKSPDKYRRLGAVMPKGVLLVGPPGTGKTLLARAIA GEAEVPFFSISASEFIEMFVGVGAARVRDMFQTARKEAPALIFIDELDAVGRSRGAGLGG GHDEREQTLNQILTEMDGFEAHENVLVLAATNRPDVLDTALLRPGRFDRKITLDRPHREA REAILKVHVRKVPLAADVDLTQVAARTTGFSGADLKNLVNEAALTAARDNLVEVNNHCFE VAHDRLILGEERDAQLTPEEREAVAYHECGHAIMAYYMPKADPLTKITIIPHGMAMGVTE QTPKEDKYNYTESYLEDRIKVMLGGRSAEKIIYGEVSTGAQNDLKEATKLLRRMVGQWGM SEKIGPLGLGIGEEHVFLGREMGAPREYSEKLAEMIDSEIQSQLLAFEAFTVSFLTEHRQ ELDALARAVMKRETLSAGEITEVLEEARSRETA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; Maqu_1017; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | A1TZE0 |
◆ Recombinant Proteins | ||
RFL2820LF | Recombinant Full Length Leucoraja Erinacea Organic Solute Transporter Subunit Alpha(Osta) Protein, His-Tagged | +Inquiry |
HSF1-29387TH | Recombinant Human HSF1, His-tagged | +Inquiry |
BZW1B-12318Z | Recombinant Zebrafish BZW1B | +Inquiry |
BTG1-10319H | Recombinant Human BTG1, GST-tagged | +Inquiry |
CRY2-647H | Recombinant Human CRY2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
HP-191E | Native Equine Haptoglobin | +Inquiry |
APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
APOC3-361H | Native Human Apolipoprotein C-III | +Inquiry |
HDLBP-86H | Native Human Lipoproteins | +Inquiry |
Lectin-1810M | Active Native Maclura Pomifera Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCF2-005HCL | Recombinant Human NCF2 cell lysate | +Inquiry |
PCDHA10-3397HCL | Recombinant Human PCDHA10 293 Cell Lysate | +Inquiry |
KIAA0430-990HCL | Recombinant Human KIAA0430 cell lysate | +Inquiry |
SESN1-1585HCL | Recombinant Human SESN1 cell lysate | +Inquiry |
PC-12-080RCL | Rat PC-12 Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket