Recombinant Full Length Malassezia Globosa Assembly Factor Cbp4(Cbp4) Protein, His-Tagged
Cat.No. : | RFL6323MF |
Product Overview : | Recombinant Full Length Malassezia globosa Assembly factor CBP4(CBP4) Protein (A8PYF7) (1-73aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Malassezia globosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-73) |
Form : | Lyophilized powder |
AA Sequence : | MAGGPANWARAITGGSVVIGFGYLLLKTATPNEQQLYDSLSPDLKRRVDAQRSSQADSER SAKVKEEQSKRLV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CBP4 |
Synonyms | CBP4; MGL_1653; Assembly factor CBP4; Cytochrome b mRNA processing protein 4 |
UniProt ID | A8PYF7 |
◆ Recombinant Proteins | ||
C1QTNF2-2569M | Recombinant Mouse C1QTNF2 Protein | +Inquiry |
RFL9672PF | Recombinant Full Length Pelobacter Carbinolicus Upf0316 Protein Pcar_2434(Pcar_2434) Protein, His-Tagged | +Inquiry |
EIF6-11182Z | Recombinant Zebrafish EIF6 | +Inquiry |
TM4SF1-981H | Active Recombinant Human TM4SF1 Transmembrane protein(VLPs) | +Inquiry |
GNPAT-1731R | Recombinant Rhesus Macaque GNPAT Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-8983P | Active Native Phaseolus vulgaris (red kidney bean) Lectin | +Inquiry |
NEFL-181B | Native bovine NEFL | +Inquiry |
Mucin-312 | Native Porcine Mucin Type II protein | +Inquiry |
HbA1c-199H | Native Human Hemoglobin A1C | +Inquiry |
Ribulose-122S | Native Ribulose-1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFKBID-3848HCL | Recombinant Human NFKBID 293 Cell Lysate | +Inquiry |
CXCL2-7168HCL | Recombinant Human CXCL2 293 Cell Lysate | +Inquiry |
APOD-8781HCL | Recombinant Human APOD 293 Cell Lysate | +Inquiry |
WBSCR16-1921HCL | Recombinant Human WBSCR16 cell lysate | +Inquiry |
HIST1H2AI-324HCL | Recombinant Human HIST1H2AI lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CBP4 Products
Required fields are marked with *
My Review for All CBP4 Products
Required fields are marked with *
0
Inquiry Basket