Recombinant Full Length Magnesium Transport Protein Cora(Cora) Protein, His-Tagged
Cat.No. : | RFL2629WF |
Product Overview : | Recombinant Full Length Magnesium transport protein CorA(corA) Protein (Q8D2T1) (1-315aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Wigglesworthia glossinidia brevipalpis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-315) |
Form : | Lyophilized powder |
AA Sequence : | MLNAFKLHKKNLFRINIDQSSLIKSIWIDIVNLTEEERRRIQNELGQNLSTSLDLEDIEA SARFFEDKEGLHIHSFFFFADAEDHVGNSTVAFIIKNNILYTLRERDLPAFRLYRMRARN QTLKDGNAYEVLLDLFETKIEQLADEIENIYSDLETLSIIIMEGRKSNEYDNALSTLAEL EDVGWKVRLCLMDTQRAINFLSKKKHIPYEQLDQAKGILHDIDSLLPHNESLFQKVNFLM QAAMGFINIEQNRIIKIFSVVSVIFLPPTLVASSYGMNFDFMPELKWPLGYPIAILEMIL AGLAPYLYFRRKKWL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | corA |
Synonyms | corA; WIGBR2730; Magnesium transport protein CorA |
UniProt ID | Q8D2T1 |
◆ Recombinant Proteins | ||
CD40-107H | Active Recombinant Human CD40 Protein, His-tagged | +Inquiry |
Pafah1b2-4656M | Recombinant Mouse Pafah1b2 Protein, Myc/DDK-tagged | +Inquiry |
CRLF1-1985M | Recombinant Mouse CRLF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL10930PF | Recombinant Full Length Pseudomonas Putida Upf0114 Protein Pput_0713 (Pput_0713) Protein, His-Tagged | +Inquiry |
FPGT-1749R | Recombinant Rhesus monkey FPGT Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-004B | Native Bovine Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Lectin-1803L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 594 labeled | +Inquiry |
Lectin-1773E | Active Native Erythrina Cristagalli Lectin Protein, Biotinylated | +Inquiry |
CP-8074M | Native Mouse Serum Ceruloplasmin | +Inquiry |
S100BB-10H | Native Human S100BB | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDAP1L1-5973HCL | Recombinant Human GDAP1L1 293 Cell Lysate | +Inquiry |
POLG2-3047HCL | Recombinant Human POLG2 293 Cell Lysate | +Inquiry |
ZC3H3-746HCL | Recombinant Human ZC3H3 lysate | +Inquiry |
CPEB1-7316HCL | Recombinant Human CPEB1 293 Cell Lysate | +Inquiry |
NDUFA10-3925HCL | Recombinant Human NDUFA10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All corA Products
Required fields are marked with *
My Review for All corA Products
Required fields are marked with *
0
Inquiry Basket