Recombinant Full Length Magnesium Transport Protein Cora(Cora) Protein, His-Tagged
Cat.No. : | RFL32911SF |
Product Overview : | Recombinant Full Length Magnesium transport protein CorA(corA) Protein (P0ABI7) (1-316aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-316) |
Form : | Lyophilized powder |
AA Sequence : | MLSAFQLENNRLTRLEVEESQPLVNAVWIDLVEPDDDERLRVQSELGQSLATRPELEDIE ASARFFEDDDGLHIHSFFFFEDAEDHAGNSTVAFTIRDGRLFTLRERELPAFRLYRMRAR SQSMVDGNAYELLLDLFETKIEQLADEIENIYSDLEQLSRVIMEGHQGDEYDEALSTLAE LEDIGWKVRLCLMDTQRALNFLVRKARLPGGQLEQAREILRDIESLLPHNESLFQKVNFL MQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELKWSFGYPGAIIFMI LAGLAPYLYFKRKNWL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | corA |
Synonyms | corA; SF3894; S3861; Magnesium transport protein CorA |
UniProt ID | P0ABI7 |
◆ Recombinant Proteins | ||
Hps4-1858M | Recombinant Mouse Hps4 protein, His & T7-tagged | +Inquiry |
CHEW-0974B | Recombinant Bacillus subtilis CHEW protein, His-tagged | +Inquiry |
TNNI2-16H | Recombinant Human TNNI2, MYC/DDK-tagged | +Inquiry |
ZNF250-5127R | Recombinant Rhesus Macaque ZNF250 Protein, His (Fc)-Avi-tagged | +Inquiry |
SGIP1-4181R | Recombinant Rhesus monkey SGIP1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
BSI-B4-851 | Active Native Bandeiraea simplicifolia Isolectin B4 protein, biotin-conjugated | +Inquiry |
F5-29S | Native Snake Russells Viper Venom Factor V Activator | +Inquiry |
VLDL-392H | Native Human Very Low Density Lipoprotein | +Inquiry |
TPO-702H | Native Human Thyroid Peroxidase | +Inquiry |
IgM-338H | Native Horse IgM | +Inquiry |
◆ Cell & Tissue Lysates | ||
C6orf25-7983HCL | Recombinant Human C6orf25 293 Cell Lysate | +Inquiry |
SLC30A9-1628HCL | Recombinant Human SLC30A9 cell lysate | +Inquiry |
SYT5-1303HCL | Recombinant Human SYT5 293 Cell Lysate | +Inquiry |
Liver-492C | Chicken Liver Lysate, Total Protein | +Inquiry |
ZNF830-293HCL | Recombinant Human ZNF830 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All corA Products
Required fields are marked with *
My Review for All corA Products
Required fields are marked with *
0
Inquiry Basket