Recombinant Full Length Macronuclear Solute Carrier Homolog Cr-Msc Protein, His-Tagged
Cat.No. : | RFL6304OF |
Product Overview : | Recombinant Full Length Macronuclear solute carrier homolog CR-MSC Protein (P15798) (1-371aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oxytricha fallax |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-371) |
Form : | Lyophilized powder |
AA Sequence : | MPTQMEVEYWRRRYQRMNYERFAAANVIALITHAATQPLDMVRIRSQMLQEGKTFSGLGY QKGWYPFQIMEEIYAAGGGLRKFYSAFDTFFFRTVCYTTARVTAFGYFYDKVNKDPRRVA RPDFLVAAGVLGGFIAGVVTNPIDIVYNRMQVDELYPQAARRNYSNTIQGLAKVAEEGAL FRGAGANGFKLAAICSSMTNIYDWCKENSYFFFGPHWINRLWGTAVAVAIGTVVSMPFDM IRTRLHTMRPLPNGQMPYNGMIDCFNKIIKYECNSKWMSNFGSFYAGGEAYFLRLFLICY LSQFLVDYYNENYYDQEFWQPQRFHYQSGIDYDIHDPYTDAFNKKLVATYTTATGGMGAA HPSGKENLAII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Macronuclear solute carrier homolog CR-MSC |
Synonyms | Macronuclear solute carrier homolog CR-MSC |
UniProt ID | P15798 |
◆ Recombinant Proteins | ||
TREM2-0792H | Active Recombinant Human TREM2 protein, Fc-tagged | +Inquiry |
IKBKB-6658Z | Recombinant Zebrafish IKBKB | +Inquiry |
ASAP1-816R | Recombinant Rat ASAP1 Protein | +Inquiry |
NKIRAS2-1087H | Recombinant Human NKIRAS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CUEDC1-11697H | Recombinant Human CUEDC1, His-tagged | +Inquiry |
◆ Native Proteins | ||
AK-14B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
Thrombin-26H | Active Native Human-Thrombin | +Inquiry |
HGF-29231TH | Native Human HGF | +Inquiry |
M. pneumoniae-28 | Native Mycoplasma pneumoniae Antigen | +Inquiry |
Lectin-1755C | Active Native Canavalia ensiformis Concanavalin A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJA4-492HCL | Recombinant Human DNAJA4 cell lysate | +Inquiry |
T-47D-2138H | T-47D (human breast duct carinoma) nuclear extract lysate | +Inquiry |
Stomach-486R | Rabbit Stomach Lysate | +Inquiry |
Lung-467C | Cat Lung Lysate, Total Protein | +Inquiry |
WDR73-336HCL | Recombinant Human WDR73 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Macronuclear solute carrier homolog CR-MSC Products
Required fields are marked with *
My Review for All Macronuclear solute carrier homolog CR-MSC Products
Required fields are marked with *
0
Inquiry Basket