Recombinant Full Length Macrolide Export Atp-Binding/Permease Protein Macb 2(Macb2) Protein, His-Tagged
Cat.No. : | RFL31712EF |
Product Overview : | Recombinant Full Length Macrolide export ATP-binding/permease protein MacB 2(macB2) Protein (P0C2H3) (1-646aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-646) |
Form : | Lyophilized powder |
AA Sequence : | MKKLIELKGVSRTYGNGDQTRTVLKNVDLTIVAGEMVAIIGASGSGKSTLMNIMGCLDVP NRGDYYIDGQNAACLSPDELARVRREHIGFIFQRYHLIPDLSALGNVEIPAIYANSERDS RRQRATALLGRLGLEGREHHKPCELSGGQQQRVSIARALINGGKIILADEPTGALDSQSG QEVLAILNELNRRGHTVVMVTHDMKVARHAKRIIELCDGEIIADSGGCVSATETLPKTNR IRQSYWKTLLDRTRESMQMALKAMKTHRLRTTLTMIGIVFGIASVVTVVALGEGARQETL EEIKSLGTNVVSIYPGQDLFDDSIESIRTLVPADANALAKQGFIDSVSPEVSASDNIRFL GKSAIASINGVGREHFRVKGIELLQGTTFRDDRNALQEVIIDENTRKAIFDNTGLQALGQ IVFLGSVPARVVGIAKSNNRSDASNRITVWMPYSTVMYRIVGKPVLTGISVRLKDNVDNE AAISAISQLLTRRHGIKDFQLYNFEQIRKSIEHTSMTFSILILMVACISLMIGSIGVMNI MLISVTERTHEIGVRMAVGARRSDIMQQFIIEAVLVCLIGGALGIALSYITGALFNALAD GIFAAIYSWQAAVAAFFCSTLIGIIFGYLPARKAARMDPVISLASE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB2 |
Synonyms | macB2; etsB; Ecok1_ColBM_46970; O1_ColBM_198; Macrolide export ATP-binding/permease protein MacB 2 |
UniProt ID | P0C2H3 |
◆ Recombinant Proteins | ||
SLC37A3-05HFL | Recombinant Full Length Human SLC37A3 Protein, GST tagged | +Inquiry |
IGF2-2501H | Recombinant Human IGF2 Protein (Ala25-Glu91), His tagged | +Inquiry |
LAMTOR3-3008R | Recombinant Rat LAMTOR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
NCSTN-3925R | Recombinant Rat NCSTN Protein | +Inquiry |
XRCC6-6488C | Recombinant Chicken XRCC6 | +Inquiry |
◆ Native Proteins | ||
IgG-01H | Native Human Immunoglobulin G | +Inquiry |
Hb-197H | Native Human Hemoglobin | +Inquiry |
LH-92P | Native Porcine LH | +Inquiry |
IgG-352G | Native HAMSTER IgG | +Inquiry |
GG-182B | Native Bovine Gamma Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSPT2-5721HCL | Recombinant Human GSPT2 293 Cell Lysate | +Inquiry |
MDA-MB-361-170H | MDA-MB-361 Whole Cell Lysate | +Inquiry |
SLC9A3R2-1693HCL | Recombinant Human SLC9A3R2 293 Cell Lysate | +Inquiry |
GPR148-5796HCL | Recombinant Human GPR148 293 Cell Lysate | +Inquiry |
SW1353-20HL | Human SW1353 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB2 Products
Required fields are marked with *
My Review for All macB2 Products
Required fields are marked with *
0
Inquiry Basket