Recombinant Full Length Macaca Mulatta (Rhesus Macaque) Potassium Voltage-Gated Channel Subfamily S Member 1(Kcns1) Protein, His-Tagged
Cat.No. : | RFL19283MF |
Product Overview : | Recombinant Full Length Macaca mulatta (Rhesus macaque) Potassium voltage-gated channel subfamily S member 1(KCNS1) Protein (A4K2T1) (1-529aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca mulatta |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-529) |
Form : | Lyophilized powder |
AA Sequence : | MLMLLVRGTHYESLRSKVVLPTPLGGRGTEALVSECPSPDTGIRWRQSDEALRVNVGGVR RLLSARALARFPGTRLGRLQAAASEEQARRLCDDYDAAAREFYFDRHPGFFLGLLHFYRT GHLHVLDELCVFAFGQEADYWGLGENALAACCRARYLERRLTQPRAWDEDSDTPSSVDPC PDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSLPSKLFSCVSISVVLASIAAMCIH SLPEYQAREAAAAVAAVAAGRSPEGVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSTRNF FCHPLNLIDIVSVLPFYLTLLAGVALGDQGGTGGKELGHLGKVVQVFRLMRIFRVLKLAR HSTGLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEDVGFNTIPACWWWGTV SMTTVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNS NHQEFEDLLSSVDGVSEASLETSRETSQEGRSADLETQAPSEPPHPQMY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNS1 |
Synonyms | KCNS1; Potassium voltage-gated channel subfamily S member 1; Delayed-rectifier K(+ channel alpha subunit 1 |
UniProt ID | A4K2T1 |
◆ Recombinant Proteins | ||
LGMN-3394R | Recombinant Rat LGMN Protein | +Inquiry |
NGLY1-6050M | Recombinant Mouse NGLY1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNPC3-7698M | Recombinant Mouse RNPC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL6681DF | Recombinant Full Length Deinococcus Geothermalis Protein Crcb Homolog 1(Crcb1) Protein, His-Tagged | +Inquiry |
TBC1D10A-6837HFL | Recombinant Full Length Human TBC1D10A protein, Flag-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1755C | Active Native Canavalia ensiformis Concanavalin A Protein | +Inquiry |
DD-170H | Active Native Human D-Dimer | +Inquiry |
Lectin-1822P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Agarose bound | +Inquiry |
FABP-178R | Native Rat Fatty acid Binding Protein | +Inquiry |
CALMODULIN-185B | Active Native Bovine Calmodulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDH16A1-56HCL | Recombinant Human ALDH16A1 cell lysate | +Inquiry |
PCDHGC4-3384HCL | Recombinant Human PCDHGC4 293 Cell Lysate | +Inquiry |
Ovary-756B | Bovine Ovary Membrane Lysate, Total Protein | +Inquiry |
AMICA1-001MCL | Recombinant Mouse AMICA1 cell lysate | +Inquiry |
DYDC1-6763HCL | Recombinant Human DYDC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNS1 Products
Required fields are marked with *
My Review for All KCNS1 Products
Required fields are marked with *
0
Inquiry Basket