Recombinant Full Length Macaca Mulatta (Rhesus Macaque) C-C Chemokine Receptor Type 5(Ccr5) Protein, His-Tagged
Cat.No. : | RFL34221MF |
Product Overview : | Recombinant Full Length Macaca mulatta (Rhesus macaque) C-C chemokine receptor type 5(CCR5) Protein (P61813) (1-352aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca mulatta |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-352) |
Form : | Lyophilized powder |
AA Sequence : | MDYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKMVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CCR5 |
Synonyms | CCR5; CMKBR5; C-C chemokine receptor type 5; C-C CKR-5; CC-CKR-5; CCR-5; CCR5; CD antigen CD195 |
UniProt ID | P61813 |
◆ Recombinant Proteins | ||
CHMP4B-3237H | Recombinant Human CHMP4B Protein, MYC/DDK-tagged | +Inquiry |
BSDC1-1217Z | Recombinant Zebrafish BSDC1 | +Inquiry |
KRT80-471H | Recombinant Human KRT80 protein, His-tagged | +Inquiry |
FILIP1-4599H | Recombinant Human FILIP1 protein, His&Myc-tagged | +Inquiry |
DNER-2080H | Recombinant Human Delta/notch-like EGF Repeat Containing, Fc Chimera | +Inquiry |
◆ Native Proteins | ||
CTSH-27404TH | Native Human CTSH | +Inquiry |
CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
CRP-59C | Native Canine C-Reactive Protein | +Inquiry |
ALB-108C | Native Cynomolgus Monkey Albumin | +Inquiry |
ALOD-36 | Active Native Alcohol oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
C14orf126-8289HCL | Recombinant Human C14orf126 293 Cell Lysate | +Inquiry |
CYP27A1-7119HCL | Recombinant Human CYP27A1 293 Cell Lysate | +Inquiry |
HNRNPC-5449HCL | Recombinant Human HNRNPC 293 Cell Lysate | +Inquiry |
OSTN-3519HCL | Recombinant Human OSTN 293 Cell Lysate | +Inquiry |
LYPLAL1-4587HCL | Recombinant Human LYPLAL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CCR5 Products
Required fields are marked with *
My Review for All CCR5 Products
Required fields are marked with *
0
Inquiry Basket