Recombinant Full Length Macaca Mulatta (Rhesus Macaque) Beta-1 Adrenergic Receptor(Adrb1) Protein, His-Tagged
Cat.No. : | RFL-9732MF |
Product Overview : | Recombinant Full Length Macaca mulatta (Rhesus macaque) Beta-1 adrenergic receptor(ADRB1) Protein (P47899) (1-480aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca mulatta |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-480) |
Form : | Lyophilized powder |
AA Sequence : | MGAGALVLGASEPGNLSSAAPLPDGVATAARLLVPASPPASLLPPASEGPEPLSQQWTAG MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPSPSPVPAPPPGPPRPAAAAAT TAPLVNGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDR LFVFFNWLGYANSAFNPIIYCRSPDFRNAFQRLLCCARRAARRRHAAHGDRPRASGCLAR PGPPPSPGAASDDDDDDVVGATQPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ADRB1 |
Synonyms | ADRB1; Beta-1 adrenergic receptor; Beta-1 adrenoreceptor; Beta-1 adrenoceptor |
UniProt ID | P47899 |
◆ Recombinant Proteins | ||
YOSH-3666B | Recombinant Bacillus subtilis YOSH protein, His-tagged | +Inquiry |
PELP1-6633M | Recombinant Mouse PELP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tmem173-1437M | Recombinant Mouse Tmem173 protein, His-tagged | +Inquiry |
MYCBP-3721Z | Recombinant Zebrafish MYCBP | +Inquiry |
TMK-1876M | Recombinant Mycobacterium Tuberculosis TMK Protein (1-214 aa), His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
Testosterone-01H | Native Human Testosterone | +Inquiry |
NEFM-1520B | Native Bovine NEFM | +Inquiry |
Calprotectin-12HFL | Native Human Calprotectin Protein | +Inquiry |
FSH-1566P | Active Native Porcine Stimulating Hormone | +Inquiry |
IGHE-214H | Native Human Immunoglobulin E (IgE) | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT8B-286HCL | Recombinant Human WNT8B 293 Cell Lysate | +Inquiry |
Fetal Diaphragm-136H | Human Fetal Diaphragm Lysate | +Inquiry |
CALR-1222HCL | Recombinant Human CALR cell lysate | +Inquiry |
PKP4-3146HCL | Recombinant Human PKP4 293 Cell Lysate | +Inquiry |
TYK2-1867HCL | Recombinant Human TYK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ADRB1 Products
Required fields are marked with *
My Review for All ADRB1 Products
Required fields are marked with *
0
Inquiry Basket