Recombinant Full Length Macaca Fascicularis Udp-Glucuronosyltransferase 2B18(Ugt2B18) Protein, His-Tagged
Cat.No. : | RFL12124MF |
Product Overview : | Recombinant Full Length Macaca fascicularis UDP-glucuronosyltransferase 2B18(UGT2B18) Protein (O97951) (22-529aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (22-529) |
Form : | Lyophilized powder |
AA Sequence : | SCGKVLVWAAEYSHWMNMKTILEELVQRGHEVTVLASSASILFDPNNSSALKIEVFPTSL TKTEFENIIRQQIKRWSELPKDTFWLYFSQMQEIMWKFGDITRNFCKDVVSNKKLMKKLQ KSRFDVVFADAIFPCSELLAELLNTPLVYSLRFTPGYNFEKHCGGFLFPPSYVPVVMSEL SDHMTFMERVKNMIYMLYFDFCFQIYAMKKWDQFYSEVLGRPTTLSETMGKADIWLIRNS WNFQFPHPLLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVTNMKEERA NVIASALAQIPQKVLWRFDGKKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGSNGIY EAIYHGVPMVGIPLFADQPDNIAHMKAKGAAVRLDFDTMSSTDLVNALKTVINDPLYKEN VMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRPAAHDLTWFQYHSLDVIGFLLACV ATVIFIIMKCCLFCFWKFARKGKKGKSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UGT2B18 |
Synonyms | UGT2B18; UDP-glucuronosyltransferase 2B18; UDPGT 2B18 |
UniProt ID | O97951 |
◆ Recombinant Proteins | ||
HDM427793H | Recombinant Human HDM4 (7-111) Protein | +Inquiry |
SHRPRBCK1R-6250Z | Recombinant Zebrafish SHRPRBCK1R | +Inquiry |
MYST2-2995C | Recombinant Chicken MYST2 | +Inquiry |
DULLARD-4082HF | Recombinant Full Length Human DULLARD Protein, GST-tagged | +Inquiry |
RFL31716AF | Recombinant Full Length Ateles Paniscus Melanocyte-Stimulating Hormone Receptor(Mc1R) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
GCT-007H | Native Human Gamma glutamyl transferases Protein | +Inquiry |
B2M-8046H | Native Human Beta 2 MicroGlobulin | +Inquiry |
IgG-166R | Native Rat IgG Fc fragment | +Inquiry |
CGA-8356H | Native Human CGA | +Inquiry |
Thrombin-26H | Active Native Human-Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
COIL-7380HCL | Recombinant Human COIL 293 Cell Lysate | +Inquiry |
ZNF213-120HCL | Recombinant Human ZNF213 293 Cell Lysate | +Inquiry |
TMEM205-969HCL | Recombinant Human TMEM205 293 Cell Lysate | +Inquiry |
NHLT-01HL | Human Non-Hodgkins Lymphoma Tumor lysate | +Inquiry |
AKT3-001MCL | Recombinant Mouse AKT3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UGT2B18 Products
Required fields are marked with *
My Review for All UGT2B18 Products
Required fields are marked with *
0
Inquiry Basket