Recombinant Full Length Human DULLARD Protein, GST-tagged

• Cat.No.: DULLARD-4082HF
• Product Overview: Human DULLARD full-length ORF ( NP_056158.2, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 244 amino acids
• Description: CTDNEP1 (CTD Nuclear Envelope Phosphatase 1) is a Protein Coding gene. Among its related pathways are Mitotic Prophase and Transport of the SLBP independent Mature mRNA. GO annotations related to this gene include phosphatase activity and protein serine/threonine phosphatase activity.
• Molecular Mass: 54.8 kDa
• AA Sequence: MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CTDNEP1 CTD nuclear envelope phosphatase 1 [ Homo sapiens (human) ]
• Official Symbol: DULLARD
• Synonyms: CTDNEP1; CTD nuclear envelope phosphatase 1; CTD Nuclear Envelope Phosphatase 1; C-Terminal Domain Nuclear Envelope Phosphatase 1; Serine/Threonine-Protein Phosphatase Dullard; DULLARD; Dullard Homolog (Xenopus Laevis); Dullard Homolog; EC 3.1.3.16; HSA011916; NET56; CTD nuclear envelope phosphatase 1; C-terminal domain nuclear envelope phosphatase 1; dullard homolog; serine/threonine-protein phosphatase dullard; EC 3.1.3.16
• Gene ID: 23399
• mRNA Refseq: NM_001143775
• Protein Refseq: NP_001137247
• MIM: 610684
• UniProt ID: O95476