Recombinant Full Length Macaca Fascicularis Transmembrane Protein C6Orf70 Homolog(Qtsa-18153) Protein, His-Tagged
Cat.No. : | RFL26849MF |
Product Overview : | Recombinant Full Length Macaca fascicularis Transmembrane protein C6orf70 homolog(QtsA-18153) Protein (Q4R6F2) (1-668aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-668) |
Form : | Lyophilized powder |
AA Sequence : | VLIGDPITTCLSPSVYDIICNLGFQLRENCDINSIVTQNGEVCWKTITDCVSYTESDQGL DYWGSVRLLGPVCEAVHSHFLSLTKGQFEIRYAPWFQWTSFPELFPEIFDALESLQSPAI SLSLMKLTSCLERALGDVFLLIGKECPFLLRDLLASEELAQVFGQSVMNVLKVFVGSPCG LNLRNVLWHGFASPEEVPPKYCSMMMLLTAGLGQLLKSYLQKTKLTLAHRSFITPTNLED LIVFPDVTYEVLSVLEEAMTKSAFILKIMLPYWEVALVKFKSHRFADCAILLLTQLETGL RNVFATLNRCPQRLLTAEILAKHLNDGKINQLPLFLGEPAMEFLWDFLNHQEGPRIRDHL SHGEINLHEFSKETTNQLLAFSVVLLLRFVDEGLLSVFKEKASVELLISLAEGYSSRCHP VFQLKKQVLSCEESIRVWALLPFPKELTWEAVRLEDNSETNACHSLITKMTDELYHHMPE DHCVLKDLDHLPTETWPQLLHELCSTPVRTLFCPRIVLEVLVVLRSIGKQCHRVSGQVTI ASELRHRQWVERTLRSRQRQNYLRMWSSIRLLSPVLSLILFLITLELVNVHAVCGKNAHE YQQYLKFVKSILQYTENLVAYTSYEKNKWNETINLTHTVLLKIWTFSEKKQMLIHLAKKS TSKVLMKT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERMARD |
Synonyms | ERMARD; QtsA-18153; Endoplasmic reticulum membrane-associated RNA degradation protein; ER membrane-associated RNA degradation protein; Fragment |
UniProt ID | Q4R6F2 |
◆ Recombinant Proteins | ||
TARDBP-2569C | Recombinant Chicken TARDBP | +Inquiry |
SNIP1-692H | Recombinant Human Smad nuclear interacting protein 1, His-tagged | +Inquiry |
RFL2782GF | Recombinant Full Length Glycine Max Atp Synthase Subunit 9, Mitochondrial(Atp9) Protein, His-Tagged | +Inquiry |
PPP2R2C-7034M | Recombinant Mouse PPP2R2C Protein, His (Fc)-Avi-tagged | +Inquiry |
OLFR510-11755M | Recombinant Mouse OLFR510 Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1797L | Active Native Lotus Tetragonolobus Lectin Protein, Biotinylated | +Inquiry |
GC-29857TH | Native Human GC | +Inquiry |
ACTC1-852B | Native Bovine ACTC1 Protein | +Inquiry |
ALB-112P | Native Pigeon Serum Albumin | +Inquiry |
S100B-256B | Native Bovine S-100 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPK11-4496HCL | Recombinant Human MAPK11 293 Cell Lysate | +Inquiry |
ITM2C-5116HCL | Recombinant Human ITM2C 293 Cell Lysate | +Inquiry |
SPRY2-1490HCL | Recombinant Human SPRY2 293 Cell Lysate | +Inquiry |
CORO2A-7342HCL | Recombinant Human CORO2A 293 Cell Lysate | +Inquiry |
CELF5-184HCL | Recombinant Human CELF5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERMARD Products
Required fields are marked with *
My Review for All ERMARD Products
Required fields are marked with *
0
Inquiry Basket