Recombinant Full Length Macaca Fascicularis Probable Cation-Transporting Atpase 13A3(Atp13A3) Protein, His-Tagged
Cat.No. : | RFL7965MF |
Product Overview : | Recombinant Full Length Macaca fascicularis Probable cation-transporting ATPase 13A3(ATP13A3) Protein (Q95JN5) (1-492aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-492) |
Form : | Lyophilized powder |
AA Sequence : | MDKEERKIINQGQEDEMEIYGYNLSRWKLAIVSLGVICTGGFLLLLLYWMPEWRVKATCV RAAIKDCDVVLLRTTDEFKMWFCAKIRVLSLETHPISSPKSMSNKLSNGHAVCLTENPTG ENRHGISKYSQAESQQIRYFTHHSVKYFWNDTIHNFDFLKGLDEGVSCTSIYEKHSAGLT KGMHAYRKLLYGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSTDEYYYYALAIVV MSIVSIVSSLYSIRKQYVMLHDMVATHSTVRVSVCRVNEEIEEIFSTDLVPGDVMVIPLN GTIMPCDAVLINGTCIVNESMLTGESVPVTKTNLPNPSVDVKGIGDELYNPETHKRHTLF CGTTVIQTRFYTGELVKAIVVRTGFSTSKGQLVRSILYPKPTDFKLYRDAYLFLLCLVAV AGIGFIYTIINSILNEVQVGVIIIESLDIITITVPPALPAAMTAGIVYAQRRLKKIGIFC ISPQRINICGQL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATP13A3 |
Synonyms | ATP13A3; AFURS1; QtsA-14967; Polyamine-transporting ATPase 13A3; ATPase family homolog up-regulated in senescence cells 1; Putrescine transporting ATPase |
UniProt ID | Q95JN5 |
◆ Recombinant Proteins | ||
RFL7965MF | Recombinant Full Length Macaca Fascicularis Probable Cation-Transporting Atpase 13A3(Atp13A3) Protein, His-Tagged | +Inquiry |
ATP13A3-846M | Recombinant Mouse ATP13A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP13A3-264H | Recombinant Human ATP13A3 Protein, His&GST-tagged | +Inquiry |
ATP13A3-2110M | Recombinant Mouse ATP13A3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP13A3 Products
Required fields are marked with *
My Review for All ATP13A3 Products
Required fields are marked with *
0
Inquiry Basket