Recombinant Full Length Macaca Fascicularis Myelin-Oligodendrocyte Glycoprotein(Mog) Protein, His-Tagged
Cat.No. : | RFL24581MF |
Product Overview : | Recombinant Full Length Macaca fascicularis Myelin-oligodendrocyte glycoprotein(MOG) Protein (Q9BGS7) (30-247aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (30-247) |
Form : | Lyophilized powder |
AA Sequence : | GQFRVIGPRQPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGRDQDGE QAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAIELKVEDPFY WVSPAVLVLLAVLPVLLLQITVGLVFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKI TLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MOG |
Synonyms | MOG; QflA-14648; Myelin-oligodendrocyte glycoprotein |
UniProt ID | Q9BGS7 |
◆ Recombinant Proteins | ||
Mog-6988M | Recombinant Mouse Mog protein(Gly29-Thr156), His-tagged | +Inquiry |
MOG-060H | Active Recombinant Human MOG Protein | +Inquiry |
MOG-4585H | Recombinant Human MOG Protein (Gly30-Tyr149), His tagged | +Inquiry |
MOG-4583H | Recombinant Human MOG Protein (Gly30-Gly154), C-His tagged | +Inquiry |
MOG-697C | Recombinant Cynomolgus MOG Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MOG-1126HCL | Recombinant Human MOG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MOG Products
Required fields are marked with *
My Review for All MOG Products
Required fields are marked with *
0
Inquiry Basket