Recombinant Full Length Macaca Fascicularis Mucolipin-1(Mcoln1) Protein, His-Tagged
Cat.No. : | RFL1577MF |
Product Overview : | Recombinant Full Length Macaca fascicularis Mucolipin-1(MCOLN1) Protein (Q60HE8) (1-580aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-580) |
Form : | Lyophilized powder |
AA Sequence : | MTDPAGPRGSETERLLTPNPGYGTQVGPSPAPPTPPEEEDLRRRLKYFFMSPCDKFRAKG RKPCKLMLQVVKILVVTVQLILFGLSNQLAVTFREENTIAFRHLFLLGYSDGADDTFAAY TQEQLYQAIFHAVDQYLALPDVSLGRYAYVHGGGDPWTNGSGLALCQRYYHRGHVDPAND TFDIDPMVVTDCIQVDPPERPPPSPSDDLALLEGSSSYKNLTLKFHKLVNVTIHFRLKTI NLQSLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFRHGDNSFRLL FDVVVILTCSLSFLLCARSLLRGFLLQNEFVRFMWRQRRRVISLWERLEFVNGWYILLVT SDVLTISGTIMKIGIEAKNLASYDVCSILLGTSTLLVWVGVIRYLTFFHNYNILIATLRV ALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFAAM QAQQGRSSLVWLFSQLYLYSFISLFIYMVLSLFIALITGAYDTIKHPGGAGAEESELQAY IAQCQDSPTSGKFRRGSGSACSLLCCCGRDPSEEHSLLVN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MCOLN1 |
Synonyms | MCOLN1; QorA-13738; Mucolipin-1; Mucolipidin; Transient receptor potential channel mucolipin 1; TRPML1 |
UniProt ID | Q60HE8 |
◆ Native Proteins | ||
Lectin-1817P | Active Native Peanut Lectin Protein, Rhodamine labeled | +Inquiry |
LDH-226H | Active Native Human Lactate Dehydrogenase Total | +Inquiry |
HRP-8336h | Active Native horseradish HRP | +Inquiry |
SAA-95H | Native Human Serum amyloid A | +Inquiry |
GCA-2H | Native Human Gastrointestinal Cancer Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLUNC-3092HCL | Recombinant Human PLUNC 293 Cell Lysate | +Inquiry |
TMEM176B-985HCL | Recombinant Human TMEM176B 293 Cell Lysate | +Inquiry |
JC-2122M | JC (mouse mammary adenocarcinoma) whole cell lysate | +Inquiry |
FBXO5-6290HCL | Recombinant Human FBXO5 293 Cell Lysate | +Inquiry |
CHST12-7507HCL | Recombinant Human CHST12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MCOLN1 Products
Required fields are marked with *
My Review for All MCOLN1 Products
Required fields are marked with *
0
Inquiry Basket