Recombinant Full Length Macaca Fascicularis Metaxin-1(Mtx1) Protein, His-Tagged
Cat.No. : | RFL13948MF |
Product Overview : | Recombinant Full Length Macaca fascicularis Metaxin-1(MTX1) Protein (Q4R3I0) (1-317aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-317) |
Form : | Lyophilized powder |
AA Sequence : | MAAPMELFCWSGGWGLPSVDLDSLAVLTYARFTGAPLKVHKISNPWRSPSGTLPALRTSH GEVISVPHKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLVHTFWIDTKNYV EVTRKWYAEAMPFPLNFFLPGRMQRQYMERLELLSGEHMPEDEEELEKELYREARECLTL LSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPSGKLQAHLRGLHNLCAYCTHILSL YFPWDGAEVPPPRQTPAGPETEEEPYRRRNQILSVLAGLAAMVGYALLSGIVSIQRATPA RAPGTRALGMAEEDEEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MTX1 |
Synonyms | MTX1; QtsA-16827; Metaxin-1; Mitochondrial outer membrane import complex protein 1 |
UniProt ID | Q4R3I0 |
◆ Recombinant Proteins | ||
HNF4A-3676HF | Recombinant Full Length Human HNF4A Protein, GST-tagged | +Inquiry |
Siglec15-1123M | Recombinant Mouse Siglec15 protein, His-tagged, Biotinylated, Primary Amine Labeling | +Inquiry |
UNKL-3601H | Recombinant Human UNKL, GST-tagged | +Inquiry |
LRRTM3-3490R | Recombinant Rat LRRTM3 Protein | +Inquiry |
THY1-3228H | Recombinant Human THY1, His-tagged | +Inquiry |
◆ Native Proteins | ||
CA 19-9-135 | Active Native Human CA 19-9 protein | +Inquiry |
HBsAg-01 | Native Hepatitis B Surface Ag protein | +Inquiry |
MBP-99S | Native Swine MBP | +Inquiry |
PLG-8H | Native Human Plasminogen, FITC Labeled | +Inquiry |
SERPINE1-29522TH | Native Human SERPINE1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PKIB-3156HCL | Recombinant Human PKIB 293 Cell Lysate | +Inquiry |
REG3A-1326RCL | Recombinant Rat REG3A cell lysate | +Inquiry |
GPR157-741HCL | Recombinant Human GPR157 cell lysate | +Inquiry |
CDC73-7645HCL | Recombinant Human CDC73 293 Cell Lysate | +Inquiry |
Adrenal-716P | Pig Adrenal, Whole Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTX1 Products
Required fields are marked with *
My Review for All MTX1 Products
Required fields are marked with *
0
Inquiry Basket