Recombinant Full Length Lysinibacillus Sphaericus Upf0754 Membrane Protein Bsph_0374 (Bsph_0374) Protein, His-Tagged
Cat.No. : | RFL24253LF |
Product Overview : | Recombinant Full Length Lysinibacillus sphaericus UPF0754 membrane protein Bsph_0374 (Bsph_0374) Protein (B1HVI2) (1-380aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lysinibacillus sphaericus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-380) |
Form : | Lyophilized powder |
AA Sequence : | MDNFIVTLLFMAIIGAAIGGVTNHLAIKMLFRPHNAIYIKNWRVPFTPGLIPKRRDELAK QLGLTVVNYLLTPETFRKKFFSKDIQEKVEQFVQTKVEETIFTNDKTIQDWLNIAGFSHM PATIEQKVEAIVEGQFASVKNTLSTKSIRTLLSSDMQDTLDAKIPVAVSHILEKGEDYFL SPEGEMTIKAMIDDFLSSKGSFGGMINMFLGDSSSLVGKVQRELVKFLQAPGTSTLLTKI FTQEWEKLKDRPAMDFLQDMQFDPILSKLQMYVKEQLAVAERLNQPISYYWPEGNEWMKN SVIPQAIDKAFVKAEEKLEDVLKRLNLQEVVREQVDSFPVEKLEELVLGISKREFKMITV LGAVLGGLIGIVQGLIVNFI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Bsph_0374 |
Synonyms | Bsph_0374; UPF0754 membrane protein Bsph_0374 |
UniProt ID | B1HVI2 |
◆ Recombinant Proteins | ||
XPNPEP1-4862H | Recombinant Human XPNPEP1 protein, His-SUMO-tagged | +Inquiry |
LRRC4B-4658H | Recombinant Human LRRC4B Protein | +Inquiry |
GNA11-3785H | Recombinant Human GNA11 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ADCYAP1-0497H | Recombinant Human ADCYAP1 Protein (Ile17-Leu176), N-GST-tagged | +Inquiry |
TNFRSF17-100R | Recombinant Rhesus macaque TNFRSF17 Protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
Lipoprotein-246 | Native Human Oxidized LDL (Ox-LDL) | +Inquiry |
MFGE8-289B | Native MFG-E8 | +Inquiry |
PTGS2-57S | Native Sheep PTGS2 Protein | +Inquiry |
TNC-08H | Native Human TNC Protein | +Inquiry |
Thrombin-23B | Native Bovine Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL17-4192HCL | Recombinant Human MRPL17 293 Cell Lysate | +Inquiry |
DDX43-457HCL | Recombinant Human DDX43 cell lysate | +Inquiry |
Uterus-Fundus-557C | Cynomolgus monkey Uterus-Fundus Lysate | +Inquiry |
SETD7-1925HCL | Recombinant Human SETD7 293 Cell Lysate | +Inquiry |
AQP9-8765HCL | Recombinant Human AQP9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Bsph_0374 Products
Required fields are marked with *
My Review for All Bsph_0374 Products
Required fields are marked with *
0
Inquiry Basket