Recombinant Full Length Lysine Exporter Protein(Lyse) Protein, His-Tagged
Cat.No. : | RFL6081CF |
Product Overview : | Recombinant Full Length Lysine exporter protein(lysE) Protein (Q6NHP1) (1-228aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Corynebacterium diphtheriae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-228) |
Form : | Lyophilized powder |
AA Sequence : | MSIAIAGFLMGLSLIVAIGPQNALIIRQGIKREGLIPILVVCILSDVILIFGGTAGVGAL VDRAPIALVVLKWLGVAYLLYFGFTCFKEAFKRHGQALAVEQSEPVAYEPVADASSGVIT KTRTKAQPKSAQRTWVKPVLAALAFTWLNPAAYIDVLVMLGGIANQHGPDGRWVFALGAL CASLTWFPFIGYTSTRFSTVLSRPAVWRYINIAIGIIMMIMCARLIMH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lysE |
Synonyms | lysE; DIP1091; Lysine exporter LysE |
UniProt ID | Q6NHP1 |
◆ Recombinant Proteins | ||
HPRT1L-290Z | Recombinant Zebrafish HPRT1L | +Inquiry |
ITGA8-6840C | Recombinant Chicken ITGA8 | +Inquiry |
TOM1-3344H | Recombinant Human TOM1, His-tagged | +Inquiry |
ASIP-7050Z | Recombinant Zebrafish ASIP | +Inquiry |
CLDN9-613H | Recombinant Human CLDN9 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
TF-8273H | Native Human Serum Transferrin HOLO(iron-saturated) | +Inquiry |
Elastase-26P | Native Pseudomonas Aeruginosa Elastase | +Inquiry |
IgA-302H | Native Human Immunoglobulin A | +Inquiry |
AHSG-111H | Native Human Alpha 2 HS Glycoprotein | +Inquiry |
BSI-B4-852 | Active Native Bandeiraea simplicifolia Isolectin B4 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD5L-2302HCL | Recombinant Human CD5L cell lysate | +Inquiry |
SLC22A2-1795HCL | Recombinant Human SLC22A2 293 Cell Lysate | +Inquiry |
ZNRD1-9194HCL | Recombinant Human ZNRD1 293 Cell Lysate | +Inquiry |
MEDAG-80HCL | Recombinant Human MEDAG lysate | +Inquiry |
MCM3-4419HCL | Recombinant Human MCM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lysE Products
Required fields are marked with *
My Review for All lysE Products
Required fields are marked with *
0
Inquiry Basket