Recombinant Full Length Lymnaea Stagnalis Octopamine Receptor 1 Protein, His-Tagged
Cat.No. : | RFL16938LF |
Product Overview : | Recombinant Full Length Lymnaea stagnalis Octopamine receptor 1 Protein (O77408) (1-638aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lymnaea stagnalis (Great pond snail) (Helix stagnalis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-638) |
Form : | Lyophilized powder |
AA Sequence : | MSRDIFMKRLRLHLLFDEVAMVTHIVGDVLSSVLLCAVVLLVLVGNTLVVAAVATSRKLR TVTNVFIVNLACADLLLGVLVLPFSAVNEIKDVWIFGHVWCQVWLAVDVWLCTASILNLC CISLDRYLAITRPIRYPGLMSAKRAKTLVAGVWLFSFVICCPPLIGWNDGGDGIMDYNGT TATPIPVTTTQTPVTGRDDVLCDNGFNYSTNSNMNTTCTYSGDSSLSTTCELTNSRGYRI YAALGSFFIPMLVMVFFYLQIYRAAVKTISAYAKGELKTKYSVRENGSKTNSVTLRIHRG GRGPSTGSSVYRHGSTYGGSAAGAATREGCGDKDAAGGRRFGRQEMDSHLPVRKCRSSDA SLVTLTGLKCEIIDNGNAKHGPISELIKGRGKSFFWRKEKKRSVGGERESFENSTRNGRS TRAKLCGGRCLAIETDICSSGECSPRTKRIKEHARATQHNSLPVTPSLSSQNEETDAVFV RGTSNSEYKPRRSRLSAHKPGHAMRLHMQKFNREKKAAKTLAIIVGAFIMCWMPFFTIYL VGAFCENCISPIVFSVAFWLGYCNSAMNPCVYALFSRDFRFAFRKLLTCSCKAWSKNRSF RPQTSDVPAIQLHCATQDDAKSSSDIGPTASGGNGGYT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Lymnaea stagnalis Octopamine receptor 1 |
Synonyms | Octopamine receptor 1; OA1 |
UniProt ID | O77408 |
◆ Recombinant Proteins | ||
PNRC2-798C | Recombinant Cynomolgus PNRC2 Protein, His-tagged | +Inquiry |
ZNF396-080H | Recombinant Human ZNF396 Protein, HIS-tagged | +Inquiry |
SPDYE2-4358H | Recombinant Human SPDYE2 Protein, GST-tagged | +Inquiry |
ENOX1-2796M | Recombinant Mouse ENOX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FBXO44-1666R | Recombinant Rhesus monkey FBXO44 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LYZ-5316H | Native Human Lysozyme(salivary) | +Inquiry |
PLAT-30920TH | Native Human PLAT | +Inquiry |
Lectin-1816P | Active Native Peanut Lectin Protein, Fluorescein labeled | +Inquiry |
GG-191P | Native Porcine Gamma Globulin protein | +Inquiry |
FGA-55R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM64A-6360HCL | Recombinant Human FAM64A 293 Cell Lysate | +Inquiry |
MRPL53-4156HCL | Recombinant Human MRPL53 293 Cell Lysate | +Inquiry |
MSRB2-4108HCL | Recombinant Human MSRB2 293 Cell Lysate | +Inquiry |
AQP10-8769HCL | Recombinant Human AQP10 293 Cell Lysate | +Inquiry |
ITPRIP-5111HCL | Recombinant Human ITPRIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lymnaea stagnalis Octopamine receptor 1 Products
Required fields are marked with *
My Review for All Lymnaea stagnalis Octopamine receptor 1 Products
Required fields are marked with *
0
Inquiry Basket