Recombinant Full Length Lymantria Dispar Multicapsid Nuclear Polyhedrosis Virus Envelope Fusion Protein(Ldorf-130) Protein, His-Tagged
Cat.No. : | RFL441LF |
Product Overview : | Recombinant Full Length Lymantria dispar multicapsid nuclear polyhedrosis virus Envelope fusion protein(LdOrf-130) Protein (Q9YMJ7) (17-676aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | LdMNPV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (17-676) |
Form : | Lyophilized powder |
AA Sequence : | FKSTDTIEVIPLPHTSGFYYQPINRMQFVEDVWHFIIEVDHGVIFQELDELYRDTLHLLN HTRSSKFVSANCTTNAIIESEINTYILKRILYLVQQHNTIDDKIKANAEGDAPDSRWELN TKDPLAPRRKRGVLNFVGTVDKFLFGVMDSNDARELHDLAKTSNALNEQIKEVTDELVNI AKFEEHKQCLERQRDDLCGYATAKMALITEQLTQLDLLYTNLDRAVDDALDNRINSLIMT PQRLYEEMTNVTVHVPTKLTWPVPLKKTNMHDLINDKIVKTHVFKLERRKLIFILEVPLI DDQNYDVYQVIPIPLCGGDGKCAVIVPDSKYLGVSTNKRNYVRLEDDAPKACKMTSKNLL CFKPKVVHVSSEATLCDIKILLHYENSYENVQRDCDVRVGKFDPEIFHLISDYNNWLYVL QRDTELTMDCADASSASNVIRIAAGTGIIRGRNVTRSCNLMTKSKQLALHQLKNSLFSVS AVPLSTSFNLSAALGDLDRLEIESMKNNADLDHKHLQGATQRLIDLRKRMNNNSVFHGAE LEGEASDGWFCWLVGWLNIKCATAEAVVACVVLFLVALLLFRIYRFCCPGTCSAMFSCCR FDALSSVPRRRNKTKSSVIRVNSQLQYLDGGGGGEKSHEETPMVMFNNRARDPNVVFKNI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LdOrf-130 |
Synonyms | LdOrf-130; Envelope fusion protein |
UniProt ID | Q9YMJ7 |
◆ Recombinant Proteins | ||
FGFBP2-4119H | Recombinant Human FGFBP2 Protein, GST-tagged | +Inquiry |
VTN-221H | Recombinant Human VTN(Val62-Leu478) Protein, C-6*His-tagged | +Inquiry |
GDF15-268H | Active Recombinant Human GDF15 | +Inquiry |
HIST1H4I-4804H | Recombinant Human HIST1H4I Protein, GST-tagged | +Inquiry |
CCZ1-1309C | Recombinant Chicken CCZ1 | +Inquiry |
◆ Native Proteins | ||
CST3-26152TH | Native Human CST3 | +Inquiry |
GCKR-8324S | Native S. cerevisiae GCKR | +Inquiry |
Lectin-1827P | Active Native Pisum Sativum Agglutinin Protein, Agarose bound | +Inquiry |
Collagen Type I-61H | Native Human Collagen Type I/III | +Inquiry |
FN1-4399H | Native Human FN1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLYATL2-5888HCL | Recombinant Human GLYATL2 293 Cell Lysate | +Inquiry |
FAM164A-6414HCL | Recombinant Human FAM164A 293 Cell Lysate | +Inquiry |
GUSB-5673HCL | Recombinant Human GUSB 293 Cell Lysate | +Inquiry |
PDF-3338HCL | Recombinant Human PDF 293 Cell Lysate | +Inquiry |
NDEL1-3937HCL | Recombinant Human NDEL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LdOrf-130 Products
Required fields are marked with *
My Review for All LdOrf-130 Products
Required fields are marked with *
0
Inquiry Basket