Recombinant Full Length Lodderomyces Elongisporus Golgi Apparatus Membrane Protein Tvp18(Tvp18) Protein, His-Tagged
Cat.No. : | RFL25613LF |
Product Overview : | Recombinant Full Length Lodderomyces elongisporus Golgi apparatus membrane protein TVP18(TVP18) Protein (A5DSM9) (1-173aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lodderomyces elongisporus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-173) |
Form : | Lyophilized powder |
AA Sequence : | MALGETITQNVFGGLSNDFKKKNFSLYGQWISIFTIFLCIALGIANIFHFNLVIIFSVIC IVQGLIVIFVEVPFLLRICPLTDTFTNFIRKFDGNLPRCGFYLLNAVIQWLSCTLQATSL IVVAIFFTLASACYALAYAKNQEYLKSSIDVTGTGQGGALEAQVGEHVVRNVL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TVP18 |
Synonyms | TVP18; LELG_00365; Golgi apparatus membrane protein TVP18 |
UniProt ID | A5DSM9 |
◆ Native Proteins | ||
CA2-33R | Native Rat Carbonic Anhydrase II (CA2) Protein | +Inquiry |
CA-13B | Active Native Bovine Carbonic Anhydrase | +Inquiry |
ECGS-32B | Native Bovine ECGS | +Inquiry |
Actin-340R | Native Rabbit Actin Protein | +Inquiry |
Collagen Type I-01B | Native Bovine Collagen Type I (Atelocollagen) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRPF3-182HCL | Recombinant Human BRPF3 cell lysate | +Inquiry |
PLAG1-3134HCL | Recombinant Human PLAG1 293 Cell Lysate | +Inquiry |
CCDC22-7773HCL | Recombinant Human CCDC22 293 Cell Lysate | +Inquiry |
Caco-2-01HL | Human Caco-2 lysate | +Inquiry |
TMOD4-914HCL | Recombinant Human TMOD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TVP18 Products
Required fields are marked with *
My Review for All TVP18 Products
Required fields are marked with *
0
Inquiry Basket