Recombinant Full Length Escherichia Coli Probable Diguanylate Cyclase Yfin(Yfin) Protein, His-Tagged
Cat.No. : | RFL35878EF |
Product Overview : | Recombinant Full Length Escherichia coli Probable diguanylate cyclase YfiN(yfiN) Protein (P46139) (1-408aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-408) |
Form : | Lyophilized powder |
AA Sequence : | MMDNDNSLNKRPTFKRALRNISMTSIFITMMLIWLLLSVTSVLTLKQYAQKNLALTAATM TYSLEAAVVFADGPAATETLAALGQQGQFSTAEVRDKQQNILASWHYTRKDPGDTFSNFI SHWLFPAPIIQPIRHNGETIGEVRLTARDSSISHFIWFSLAVLTGCILLASGIAITLTRH LHNGLVEALKNITDVVHDVRSNRNFSRRVSEERIAEFHRFALDFNSLLDEMEEWQLRLQA KNAQLLRTALHDPLTGLANRAAFRSGINTLMNNSDARKTSALLFLDGDNFKYINDTWGHA TGDRVLIEIAKRLAEFGGLRHKAYRLGGDEFAMVLYDVQSESEVQQICSALTQIFNLPFD LHNGHQTTMTLSIGYAMTIEHASAEKLQELADHNMYQAKHQRAEKLVR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dgcN |
Synonyms | dgcN; yfiN; b2604; JW2585; Diguanylate cyclase DgcN; DGC |
UniProt ID | P46139 |
◆ Recombinant Proteins | ||
QPRT-13764M | Recombinant Mouse QPRT Protein | +Inquiry |
OFD1-1242Z | Recombinant Zebrafish OFD1 | +Inquiry |
CASC4-0409H | Recombinant Human CASC4 Protein, GST-Tagged | +Inquiry |
GRK5-7708Z | Recombinant Zebrafish GRK5 | +Inquiry |
MFN2-103H | Recombinant Human MFN2 Full Length Transmembrane protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
SRC-29697TH | Native Human SRC | +Inquiry |
TroponinCIT-33HFL | Native Full Length Human Cardiac Troponin C-I-T Complex | +Inquiry |
Lectin-1761A | Active Native Agaricus bisporus lectin Protein, Fluorescein labeled | +Inquiry |
APOA1-8344H | Native Human APOA1 | +Inquiry |
CKB-8079H | Active Native Human CKB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
WBP1L-8370HCL | Recombinant Human C10orf26 293 Cell Lysate | +Inquiry |
HSD11B2-5378HCL | Recombinant Human HSD11B2 293 Cell Lysate | +Inquiry |
HSD17B3-5374HCL | Recombinant Human HSD17B3 293 Cell Lysate | +Inquiry |
B3GALTL-1103HCL | Recombinant Human B3GALTL cell lysate | +Inquiry |
WSB2-280HCL | Recombinant Human WSB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dgcN Products
Required fields are marked with *
My Review for All dgcN Products
Required fields are marked with *
0
Inquiry Basket