Recombinant Full Length Locusta Migratoria Tyramine Receptor 1(Gcr1) Protein, His-Tagged
Cat.No. : | RFL29342LF |
Product Overview : | Recombinant Full Length Locusta migratoria Tyramine receptor 1(GCR1) Protein (Q25321) (1-484aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Locusta migratoria (Migratory locust) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-484) |
Form : | Lyophilized powder |
AA Sequence : | MVRVELQAASLMNGSSAAEEPQDALVGGDACGGRRPPSVLGVRLAVPEWEVAVTAVSLSL IILITIVGNVLVVLSVFTYKPLRIVQNFFIVSLAVADLTVAVLVMPFNVAYSLIQRWVFG IVVCKMWLTCDVLCCTASILNLCAIALDRYWAITDPINYAQKRTLRRVLAMIAGVWLLSG VISSPPLIGWNDWPMEFNDTTPCQLTEEQGYVIYSSLGSFFIPLFIMTIVYVEIFIATKR RLRERAKASKLNSAMKQQMAAQAVPSSVPSHDQESVSSETNHNELPPPPAPPSKEKRRKT KKKSKKKEQAAEEGRFLAPAMVAEDSVTDNSVSVGPVARNHLAEDGYTCTTTTTTTTTTT AVTDSPRSRTASQKGSTAPPTPVQPKSIPVYQFIEEKQRISLSKERRAARTLGIIMGVFV VCWLPFFLMYVIVPFCNPSCKPSPKLVNFITWLGYINSALNPIIYTIFNLDFRRAFKKLL HFKT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GCR1 |
Synonyms | GCR1; Tyramine receptor 1; Tyr-Loc1 |
UniProt ID | Q25321 |
◆ Recombinant Proteins | ||
EPHA2-359H | Recombinant Human EPHA2 Protein, DDK/His-tagged | +Inquiry |
CASP8-1146R | Recombinant Rat CASP8 Protein | +Inquiry |
SQSTM1-30116H | Recombinant Human SQSTM1 protein, GST-tagged | +Inquiry |
FOXF1-511H | Recombinant Human FOXF1 | +Inquiry |
ASPN-2003H | Recombinant Human ASPN Protein (33-380 aa), His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
ALA-02B | Native Bovine α-Lactalbumin Protein | +Inquiry |
APCS-31189TH | Native Human APCS | +Inquiry |
PTGS1-141S | Native Sheep PTGS1 Protein | +Inquiry |
CA2-32S | Native Sheep Carbonic Anhydrase II (CA2) Protein | +Inquiry |
NEFH-180B | Native bovine NEFH | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLNS1A-7437HCL | Recombinant Human CLNS1A 293 Cell Lysate | +Inquiry |
ULK3-1883HCL | Recombinant Human ULK3 cell lysate | +Inquiry |
CYP27B1-7118HCL | Recombinant Human CYP27B1 293 Cell Lysate | +Inquiry |
CNNM1-191HCL | Recombinant Human CNNM1 lysate | +Inquiry |
TCEB2-1188HCL | Recombinant Human TCEB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GCR1 Products
Required fields are marked with *
My Review for All GCR1 Products
Required fields are marked with *
0
Inquiry Basket