Recombinant Full Length Listeria Monocytogenes Serovar 1/2A Upf0316 Protein Lmo1776(Lmo1776) Protein, His-Tagged
Cat.No. : | RFL13643LF |
Product Overview : | Recombinant Full Length Listeria monocytogenes serovar 1/2a UPF0316 protein lmo1776(lmo1776) Protein (Q8Y6B5) (1-174aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Listeria Monocytogenes Serovar 1/2a |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-174) |
Form : | Lyophilized powder |
AA Sequence : | MDNGIFIVVTIFIVNILYVTIYTVRLLLTMKGYRYLAALSSVFEMIIYVVALSLVLDNLN NIANVLAYAVGFGVGIIVGMKIEERIALGYITVNVITKEYNLDLPNQIRDLGYGVTSWLA SGRDGERMMLEILTQRKNERKLYKHIIEIDNGAFIVSSEPKQIHGGFWVKQVRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lmo1776 |
Synonyms | lmo1776; UPF0316 protein lmo1776 |
UniProt ID | Q8Y6B5 |
◆ Native Proteins | ||
RNASE1-392C | Native Cattle RNASE1 Protein | +Inquiry |
Casein-01B | Active Native Bovine Casein Protein | +Inquiry |
Pa-27F | Native Feline Parvovirus Antigen | +Inquiry |
eCG-01E | Active Native Equine Gonadotropin protein | +Inquiry |
Fibronectin-49H | Native Hamster Fibronectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
VPS26A-394HCL | Recombinant Human VPS26A 293 Cell Lysate | +Inquiry |
CD8B-001HCL | Recombinant Human CD8B cell lysate | +Inquiry |
CGA-001HCL | Recombinant Human CGA cell lysate | +Inquiry |
FAM151A-6423HCL | Recombinant Human FAM151A 293 Cell Lysate | +Inquiry |
TNFSF13-1346MCL | Recombinant Mouse TNFSF13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lmo1776 Products
Required fields are marked with *
My Review for All lmo1776 Products
Required fields are marked with *
0
Inquiry Basket