Recombinant Full Length Listeria Monocytogenes Serovar 1/2A Actin Assembly-Inducing Protein(Acta) Protein, His-Tagged
Cat.No. : | RFL15898LF |
Product Overview : | Recombinant Full Length Listeria monocytogenes serovar 1/2a Actin assembly-inducing protein(actA) Protein (P33379) (30-639aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Listeria Monocytogenes Serovar 1/2a |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (30-639) |
Form : | Lyophilized powder |
AA Sequence : | ATDSEDSSLNTDEWEEEKTEEQPSEVNTGPRYETAREVSSRDIKELEKSNKVRNTNKADL IAMLKEKAEKGPNINNNNSEQTENAAINEEASGADRPAIQVERRHPGLPSDSAAEIKKRR KAIASSDSELESLTYPDKPTKVNKKKVAKESVADASESDLDSSMQSADESSPQPLKANQQ PFFPKVFKKIKDAGKWVRDKIDENPEVKKAIVDKSAGLIDQLLTKKKSEEVNASDFPPPP TDEELRLALPETPMLLGFNAPATSEPSSFEFPPPPTDEELRLALPETPMLLGFNAPATSE PSSFEFPPPPTEDELEIIRETASSLDSSFTRGDLASLRNAINRHSQNFSDFPPIPTEEEL NGRGGRPTSEEFSSLNSGDFTDDENSETTEEEIDRLADLRDRGTGKHSRNAGFLPLNPFA SSPVPSLSPKVSKISAPALISDITKKTPFKNPSQPLNVFNKKTTTKTVTKKPTPVKTAPK LAELPATKPQETVLRENKTPFIEKQAETNKQSINMPSLPVIQKEATESDKEEMKPQTEEK MVEESESANNANGKNRSAGIEEGKLIAKSAEDEKAKEEPGNHTTLILAMLAIGVFSLGAF IKIIQLRKNN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | actA |
Synonyms | actA; prtB; lmo0204; Actin assembly-inducing protein |
UniProt ID | P33379 |
◆ Native Proteins | ||
APCS-31189TH | Native Human APCS | +Inquiry |
PLG -38C | Native Chicken plasmin | +Inquiry |
Lectin-1733L | Active Native Lens Culinaris Agglutinin Protein, Rhodamine labeled | +Inquiry |
PLE-105P | Active Native Porcine Esterase | +Inquiry |
FG-163B | Native Bovine fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMB2-2774HCL | Recombinant Human PSMB2 293 Cell Lysate | +Inquiry |
CAMP-7871HCL | Recombinant Human CAMP 293 Cell Lysate | +Inquiry |
MRPS23-4143HCL | Recombinant Human MRPS23 293 Cell Lysate | +Inquiry |
IL12A & IL12B-1781MCL | Recombinant Mouse IL12A & IL12B Overexpression Lysate(Met 1-Ala 215&Met 1-Ser 335) | +Inquiry |
P2RX5-3498HCL | Recombinant Human P2RX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All actA Products
Required fields are marked with *
My Review for All actA Products
Required fields are marked with *
0
Inquiry Basket