Recombinant Full Length Liriodendron Tulipifera Nad(P)H-Quinone Oxidoreductase Subunit 3, Chloroplastic(Ndhc) Protein, His-Tagged
Cat.No. : | RFL34882LF |
Product Overview : | Recombinant Full Length Liriodendron tulipifera NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic(ndhC) Protein (Q0G9L4) (1-120aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Liriodendron tulipifera (Tuliptree) (Tulip poplar) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-120) |
Form : | Lyophilized powder |
AA Sequence : | MFLLHEYDIFWAFLIISSVIPILAFLISGVLAPISEGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLIPIVGSVYAWRKGALEWS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhC |
Synonyms | ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3 |
UniProt ID | Q0G9L4 |
◆ Recombinant Proteins | ||
DIS3-12004H | Recombinant Human DIS3, His-tagged | +Inquiry |
KCNA3-2166R | Recombinant Rhesus Macaque KCNA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL1916RF | Recombinant Full Length Rhinolophus Pumilus Nadh-Ubiquinone Oxidoreductase Chain 4L(Mt-Nd4L) Protein, His-Tagged | +Inquiry |
TRUB2-417Z | Recombinant Zebrafish TRUB2 | +Inquiry |
SPTAN1-31H | Recombinant Human SPTAN1, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-349H | Native Horse Gamma Globulin Fraction | +Inquiry |
LHB-8212H | Native Luteinizing Beta Subunit Hormone | +Inquiry |
KS-01G | Active Native Goat KS Protein | +Inquiry |
IgY-006D | Native Duck IgY | +Inquiry |
Factor B-60H | Native Human Factor B | +Inquiry |
◆ Cell & Tissue Lysates | ||
ISY1-5142HCL | Recombinant Human ISY1 293 Cell Lysate | +Inquiry |
FOLR3-6169HCL | Recombinant Human FOLR3 293 Cell Lysate | +Inquiry |
MAGT1-4532HCL | Recombinant Human MAGT1 293 Cell Lysate | +Inquiry |
C14orf166B-8280HCL | Recombinant Human C14orf166B 293 Cell Lysate | +Inquiry |
ATG7-8621HCL | Recombinant Human ATG7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndhC Products
Required fields are marked with *
My Review for All ndhC Products
Required fields are marked with *
0
Inquiry Basket