Recombinant Full Length Lipopolysaccharide Export System Permease Protein Lptf(Lptf) Protein, His-Tagged
Cat.No. : | RFL17976EF |
Product Overview : | Recombinant Full Length Lipopolysaccharide export system permease protein lptF(lptF) Protein (P0AF99) (1-366aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-366) |
Form : | Lyophilized powder |
AA Sequence : | MIIIRYLVRETLKSQLAILFILLLIFFCQKLVRILGAAVDGDIPANLVLSLLGLGVPEMA QLILPLSLFLGLLMTLGKLYTESEITVMHACGLSKAVLVKAAMILAVFTAIVAAVNVMWA GPWSSRHQDEVLAEAKANPGMAALAQGQFQQATNGSSVLFIESVDGSDFKDVFLAQIRPK GNARPSVVVADSGHLTQLRDGSQVVTLNQGTRFEGTALLRDFRITDFQDYQAIIGHQAVA LDPNDTDQMDMRTLWNTDTDRARAELNWRITLVFTVFMMALMVVPLSVVNPRQGRVLSML PAMLLYLLFFLIQTSLKSNGGKGKLDPTLWMWTVNLIYLALAIVLNLWDTVPVRRLRASF SRKGAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lptF |
Synonyms | lptF; c5362; Lipopolysaccharide export system permease protein LptF |
UniProt ID | P0AF99 |
◆ Recombinant Proteins | ||
CEP135-1223H | Recombinant Human CEP135 protein, GST-tagged | +Inquiry |
STX12-5808R | Recombinant Rat STX12 Protein | +Inquiry |
ARHGAP44-685M | Recombinant Mouse ARHGAP44 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL36529HF | Recombinant Full Length Human Epoxide Hydrolase 1(Ephx1) Protein, His-Tagged | +Inquiry |
GPC3-1537H | Recombinant Human GPC3 Transmembrane protein, VLP | +Inquiry |
◆ Native Proteins | ||
Prothrombin-92M | Native Mouse Prothrombin | +Inquiry |
C3a-08H | Native Human Complement C3 alpha protein | +Inquiry |
LDH-217R | Active Native Rabbit Lactate Dehydrogenase | +Inquiry |
Thrombin-27B | Active Native Bovine alpha-Thrombin | +Inquiry |
BCHE-5291H | Native Human Butyrylcholinesterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALNT2-907HCL | Recombinant Human GALNT2 cell lysate | +Inquiry |
INPP1-5200HCL | Recombinant Human INPP1 293 Cell Lysate | +Inquiry |
SYT5-1303HCL | Recombinant Human SYT5 293 Cell Lysate | +Inquiry |
NDUFA8-3915HCL | Recombinant Human NDUFA8 293 Cell Lysate | +Inquiry |
IL23-1893HCL | Recombinant Human IL23 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lptF Products
Required fields are marked with *
My Review for All lptF Products
Required fields are marked with *
0
Inquiry Basket