Recombinant Full Length Leuconostoc Citreum Upf0397 Protein Lck_00164 (Lck_00164) Protein, His-Tagged
Cat.No. : | RFL8506LF |
Product Overview : | Recombinant Full Length Leuconostoc citreum UPF0397 protein LCK_00164 (LCK_00164) Protein (B1MWU5) (1-188aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Leuconostoc citreum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-188) |
Form : | Lyophilized powder |
AA Sequence : | MHNQKKNQGFSVKSVVATGIGAAVFFVLMKFIAIPTGVPNTTINVAEGWLALIAGLFGPV VGLLVGLIGHTLNDAVTYGAPWWSWVIADGVFGLLLGFGKKYLALEYGELTTKKLVQFNV WQAVSNVLVWVIIAPLGDIIIYKEAAQKVFLQGAVTTVVNTISVAIIGSLLLVAYVKSRP KKSSLRSE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LCK_00164 |
Synonyms | LCK_00164; UPF0397 protein LCK_00164 |
UniProt ID | B1MWU5 |
◆ Native Proteins | ||
F12-13H | Native Human Factor beta-XIIa, Biotin Labeled | +Inquiry |
Collagen-01B | Native Bovine Type II Collagen | +Inquiry |
IgG-169H | Native Human IgG Fc fragment | +Inquiry |
GOT1-01H | Active Native Human GOT1 Protein | +Inquiry |
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOX9-1555HCL | Recombinant Human SOX9 293 Cell Lysate | +Inquiry |
TNFRSF1B-2192MCL | Recombinant Mouse TNFRSF1B cell lysate | +Inquiry |
RNASE13-2321HCL | Recombinant Human RNASE13 293 Cell Lysate | +Inquiry |
BMP2-3075HCL | Recombinant Human BMP2 cell lysate | +Inquiry |
CREG1-1069MCL | Recombinant Mouse CREG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LCK_00164 Products
Required fields are marked with *
My Review for All LCK_00164 Products
Required fields are marked with *
0
Inquiry Basket