Recombinant Full Length Leptospira Interrogans Serogroup Icterohaemorrhagiae Serovar Lai Apolipoprotein N-Acyltransferase 2(Lnt2) Protein, His-Tagged
Cat.No. : | RFL7144LF |
Product Overview : | Recombinant Full Length Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Apolipoprotein N-acyltransferase 2(lnt2) Protein (Q8EYY4) (1-595aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-595) |
Form : | Lyophilized powder |
AA Sequence : | MDTLHHRFQQFQKTIWFNIFCYLWTGIFSFLAFAPVSLTHFVWIAPFGFFWLSLKYHGKY KKLFFHGLLIGVVFYAISFHWIIHMAITFGNFPYVVAILILLFAGLLFGLKFPIFMMSFS FLSGKIGRHSVWVAGFCGLLSELIGPQLFPWYWGNLAAGNIILAQNAEITGVYGISFLVF IVSYTLFQSNPWHWKEIIHSKEKRKQYLRFITLPALLLLTFIVSGIFLFKKWENVKPVKS LNVLIVQPDAPLSFRDGREIKESIEALMARIEKLTDEGAVRLGKKPDLIVLPEAGVPFFS AHKTEITTKVRRMYWDRFDSLMFLLANRYKANVFFNEIDAGFKGAPSPRNLRYYNNNVLY DPNGDRRDSYQKKFLLMFGEYMPFDFLYELSQQTGRFEPGLTHNLIRYYTPRYYTLAEKE KSPKGRHLGWTDTETFNHEAVRSYYETTRTEVSETGKFLPLICYEVILPEFVREFRTAGN PEFIVNLTNDKWYGATTESDQHMELGRLRSIELRRWMVRSTNSGISANIDHLGRFVGNKK TGLMTAEALSETIDVIDSPPTFYTQYGNLIPWLMLFLTGIYYLNLLIGIRRGKSA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lnt2 |
Synonyms | lnt2; LA_4078; Apolipoprotein N-acyltransferase 2; ALP N-acyltransferase 2 |
UniProt ID | Q8EYY4 |
◆ Recombinant Proteins | ||
POU5F2-13148M | Recombinant Mouse POU5F2 Protein | +Inquiry |
MET-28602TH | Recombinant Human MET | +Inquiry |
SAOUHSC-02712-3782S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_02712 protein, His-tagged | +Inquiry |
Slamf6-6808M | Recombinant Mouse Slamf6 Protein (Glu31-Asn239), N-His tagged | +Inquiry |
Cep19-2112M | Recombinant Mouse Cep19 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
DI-24 | Active Native Diaphorase (NADH) | +Inquiry |
Thrombin-28B | Active Native Bovine alpha-Thrombin-DFP | +Inquiry |
ALPI-5B | Active Native Bovine Alkaline Phosphatase | +Inquiry |
Lectin-1774E | Active Native Erythrina Cristagalli Lectin Protein, Fluorescein labeled | +Inquiry |
Thrombin-27B | Active Native Bovine alpha-Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOT2-302HCL | Recombinant Human GOT2 lysate | +Inquiry |
NUDT18-3649HCL | Recombinant Human NUDT18 293 Cell Lysate | +Inquiry |
CNTN2-1518MCL | Recombinant Mouse CNTN2 cell lysate | +Inquiry |
C3orf36-8047HCL | Recombinant Human C3orf36 293 Cell Lysate | +Inquiry |
GSC-5728HCL | Recombinant Human GSC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lnt2 Products
Required fields are marked with *
My Review for All lnt2 Products
Required fields are marked with *
0
Inquiry Basket