Recombinant Full Length Leptosphaeria Maculans Bifunctional Lycopene Cyclase/Phytoene Synthase (Lema_P114090.1) Protein, His-Tagged
Cat.No. : | RFL20516LF |
Product Overview : | Recombinant Full Length Leptosphaeria maculans Bifunctional lycopene cyclase/phytoene synthase (Lema_P114090.1) Protein (E4ZUB5) (1-581aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Leptosphaeria maculans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-581) |
Form : | Lyophilized powder |
AA Sequence : | MGFDYALVHLKYTIPPAVLLTLLYRPLLTKIDVYKVAFLVTIAVVATIPWDSYLIRNRIW SYPDHVIIGPTLFDIPLEEVFFFVVQTYNTSLLYLVLSKPTFQPVYLCTERDELHGSWRL KRLIGQAILLGAIAWGWFCVRERGLGTYTGLILIWAGPFLLLLWSLAYQFIIGLPFTNTL LPIVLPTLYLWIVDTLALRRGTWVISPGTKFGVHLWDGLEIEEALFFLLTNVLIVFGQLA FDNALAVLYAFPHLFPDPSLLPSPATLIRSLLTSCAQYDEARLTGFREAVSRLKRKSRSF YLASSTFQGPLRMDLLLLYSFCRVADDLVDNAATTEEARQWIAKLHKFLDNVYRKDVVCS SVTDQVRKEFPLDTHSALLQLPCCKLSAEPLRDLLRGFEMDLEFNSTSPIQSTEDLVLYS ERVAGTVAQMCIQLIFHLYPSSLTAEKRHKVVAAGNSMGVALQYVNIARDIGVDAKIGRV YLPTDWLSEVGLNCDTVLKDPKDPRIEALRGRLLDDAFSFYEEAKLAIAQLPIEAQGPIR VAVESYMEIGRTLKQDGFIVKAGRATVPKWRRVLVAWRTLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Lema_P114090.1 |
Synonyms | Lema_P114090.1; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ] |
UniProt ID | E4ZUB5 |
◆ Recombinant Proteins | ||
UST-3378Z | Recombinant Zebrafish UST | +Inquiry |
BTBD11-1658HF | Recombinant Full Length Human BTBD11 Protein, GST-tagged | +Inquiry |
S100P-387HFL | Recombinant Full Length Human S100P Protein, C-Flag-tagged | +Inquiry |
RFL24441SF | Recombinant Full Length Staphylococcus Aureus Putative Antiporter Subunit Mnhe2(Mnhe2) Protein, His-Tagged | +Inquiry |
TNFRSF17-04H | Active Recombinant Human TNFRSF17 Protein, Fc-tagged, Atto 647N conjugated | +Inquiry |
◆ Native Proteins | ||
IgM-208M | Native Monkey Immunoglobulin M | +Inquiry |
APOC3-8040H | Native Human ApoLipoprotein CIII | +Inquiry |
COL1A1-26195TH | Native Human COL1A1 | +Inquiry |
Chymotrypsin-163B | Active Native Bovine Chymotrypsin | +Inquiry |
LLC-231H | Native Human Lambda Light Chain | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDE7A-3342HCL | Recombinant Human PDE7A 293 Cell Lysate | +Inquiry |
HLA-DRB3-798HCL | Recombinant Human HLA-DRB3 cell lysate | +Inquiry |
ATF7-145HCL | Recombinant Human ATF7 cell lysate | +Inquiry |
HAVCR1-2394RCL | Recombinant Rat HAVCR1 cell lysate | +Inquiry |
AHNAK2-42HCL | Recombinant Human AHNAK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lema_P114090.1 Products
Required fields are marked with *
My Review for All Lema_P114090.1 Products
Required fields are marked with *
0
Inquiry Basket