Recombinant Full Length Lepidium Virginicum Nad(P)H-Quinone Oxidoreductase Subunit 3, Chloroplastic Protein, His-Tagged
Cat.No. : | RFL31320LF |
Product Overview : | Recombinant Full Length Lepidium virginicum NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic Protein (A4QLB1) (1-120aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lepidium virginicum (Virginia pepperweed) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-120) |
Form : | Lyophilized powder |
AA Sequence : | MFLLYEYDIFWAFLIISSAIPVLAFLISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEALIFVLILILGLVYAWRKGALEWS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhC |
Synonyms | ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3 |
UniProt ID | A4QLB1 |
◆ Recombinant Proteins | ||
RHBG-10425Z | Recombinant Zebrafish RHBG | +Inquiry |
IL15-0177C | Active Recombinant Cynomolgus / Rhesus macaque IL15 protein, His-tagged | +Inquiry |
TMEM52-5928H | Recombinant Human TMEM52 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CRYAB-2734H | Recombinant Human CRYAB protein, His-SUMO-tagged | +Inquiry |
PPIE-1885H | Recombinant Human PPIE, GST-tagged | +Inquiry |
◆ Native Proteins | ||
PSMA3-419S | Active Native S. aureus PSM-alpha 3 protein | +Inquiry |
Collagen Type I & III-04B | Native Bovine Collagen Type I and III Protein | +Inquiry |
Lectin-1724C | Native Canavalia ensiformis Lectin | +Inquiry |
RB5200-3281H | Native Human RB5200 | +Inquiry |
Collagen-46M | Native Mouse Collagen protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC4F-1114RCL | Recombinant Rat CLEC4F cell lysate | +Inquiry |
Salivary-623R | Rat Mandibular Lysate, Total Protein | +Inquiry |
C11orf68-8338HCL | Recombinant Human C11orf68 293 Cell Lysate | +Inquiry |
GLRX3-5897HCL | Recombinant Human GLRX3 293 Cell Lysate | +Inquiry |
MS4A3-4125HCL | Recombinant Human MS4A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ndhC Products
Required fields are marked with *
My Review for All ndhC Products
Required fields are marked with *
0
Inquiry Basket