Recombinant Full Length Lactuca Sativa Photosystem Ii Reaction Center Protein H(Psbh) Protein, His-Tagged
Cat.No. : | RFL9574LF |
Product Overview : | Recombinant Full Length Lactuca sativa Photosystem II reaction center protein H(psbH) Protein (Q332U8) (2-73aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lactuca sativa (Garden lettuce) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-73) |
Form : | Lyophilized powder |
AA Sequence : | ATQTVENGARSGPRRTTVGDLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIY NSSVLLDGISMN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbH |
Synonyms | psbH; Photosystem II reaction center protein H; PSII-H; Photosystem II 10 kDa phosphoprotein |
UniProt ID | Q332U8 |
◆ Recombinant Proteins | ||
KRTAP4-1-3291H | Recombinant Human KRTAP4-1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FA2H-501C | Recombinant Cynomolgus FA2H Protein, His-tagged | +Inquiry |
ASPHD2-487R | Recombinant Rat ASPHD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Neil1-4365M | Recombinant Mouse Neil1 Protein, Myc/DDK-tagged | +Inquiry |
TSG101-3422H | Recombinant Human TSG101 Protein (Pro144-Leu373), His tagged | +Inquiry |
◆ Native Proteins | ||
GC-29857TH | Native Human GC | +Inquiry |
Fgb-64R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
Factor Ixa-62H | Native Human Factor Ixa | +Inquiry |
Tryptase-01H | Active Native Human Tryptase Protein | +Inquiry |
DIS-2019 | Active Alpha-Cyclomaltodextrin glucanotransferase | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAT6-481HCL | Recombinant Human STAT6 cell lysate | +Inquiry |
ING2-5208HCL | Recombinant Human ING2 293 Cell Lysate | +Inquiry |
PITX2-3164HCL | Recombinant Human PITX2 293 Cell Lysate | +Inquiry |
SCML2-2032HCL | Recombinant Human SCML2 293 Cell Lysate | +Inquiry |
WDR72-337HCL | Recombinant Human WDR72 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbH Products
Required fields are marked with *
My Review for All psbH Products
Required fields are marked with *
0
Inquiry Basket