Recombinant Full Length Photosystem Ii Reaction Center Protein H(Psbh) Protein, His-Tagged
Cat.No. : | RFL18321PF |
Product Overview : | Recombinant Full Length Photosystem II reaction center protein H(psbH) Protein (P31095) (1-64aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Prochlorothrix hollandica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-64) |
Form : | Lyophilized powder |
AA Sequence : | MGQKTALSNFLKPFNSNAGKVVPGWGTTPLMGLFMGLLFVFLLIILQIYNSTIVLDAFSV NVGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbH |
Synonyms | psbH; Photosystem II reaction center protein H; PSII-H |
UniProt ID | P31095 |
◆ Recombinant Proteins | ||
EMD-2767M | Recombinant Mouse EMD Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM114-4765R | Recombinant Rhesus monkey TMEM114 Protein, His-tagged | +Inquiry |
IL12B-179H | Recombinant Human IL12B Protein, DDK-tagged | +Inquiry |
IL2RB-454R | Active Recombinant Rhesus IL2RB protein(Met1-Asp239), hFc-tagged | +Inquiry |
PNMAL1-2409H | Recombinant Human PNMAL1 Protein, GST/His-tagged | +Inquiry |
◆ Native Proteins | ||
RWX-308S | Native Snake RVV-X ACTIVATOR | +Inquiry |
T.gondii-39 | Native Toxoplasma gondii Antigen | +Inquiry |
Collagen Type III-07H | Native Human Collagen Type III | +Inquiry |
IgG-349H | Native Horse Gamma Globulin Fraction | +Inquiry |
CRP-8057H | Native C-Reactive Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC124-7784HCL | Recombinant Human CCDC124 293 Cell Lysate | +Inquiry |
ELMO1-6622HCL | Recombinant Human ELMO1 293 Cell Lysate | +Inquiry |
Prostate-401H | Human Prostate Cytoplasmic Lysate | +Inquiry |
TOMM70A-1809HCL | Recombinant Human TOMM70A cell lysate | +Inquiry |
SIT1-1827HCL | Recombinant Human SIT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbH Products
Required fields are marked with *
My Review for All psbH Products
Required fields are marked with *
0
Inquiry Basket