Recombinant Full Length Lactococcus Lactis Subsp. Cremoris Energy-Coupling Factor Transporter Transmembrane Protein Ecft(Ecft) Protein, His-Tagged
Cat.No. : | RFL16651LF |
Product Overview : | Recombinant Full Length Lactococcus lactis subsp. cremoris Energy-coupling factor transporter transmembrane protein EcfT(ecfT) Protein (A2RI03) (1-266aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lactococcus lactis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-266) |
Form : | Lyophilized powder |
AA Sequence : | MQNMLMGRYIPGDSIIHRMDPRSKLLVMIAFVVIIFLAHDWLGYLLLVLYTLAGVLLSKI SVSYFLRGLRPMIGLILFTVIFQMLFTNGQHVIFSLWFIKISTESLINAVYIFFRFVLII FMSTILTLTTPPLTLADGIEKGLGPLKKIKVPVHELGLMLSISLRFIPTLMDDTTMIMNA QKARGMDFGEGNLLKKIKSVIPILIPLFVSSFRRADDLAVAMESRGYQGGDGRTKYRQLK WQSRDSLLVVSIIIMTILLILWSKVS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ecfT |
Synonyms | ecfT; llmg_0289; Energy-coupling factor transporter transmembrane protein EcfT |
UniProt ID | A2RI03 |
◆ Recombinant Proteins | ||
Mars2-3963M | Recombinant Mouse Mars2 Protein, Myc/DDK-tagged | +Inquiry |
SIKE1-521H | Recombinant Human suppressor of IKBKE 1, His-tagged | +Inquiry |
ITGB1BP2-178H | Recombinant Human ITGB1BP2, GST-tagged | +Inquiry |
HSV1gGAg-356H | Recombinant Herpes Simplex Virus 1 gG Protein (Met1-Asp190) | +Inquiry |
RAD51D-3407H | Recombinant Full Length Human RAD51D Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ctxB-01V | Native Vibrio cholerae ctxB Protein | +Inquiry |
ATF-24B | Native Bovine Bovine Apo Transferrin | +Inquiry |
Testis-022H | Human Testis Lysate, Total Protein | +Inquiry |
Collagen-44H | Native Human Collagen I | +Inquiry |
Fgg -69R | Native Rat Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM4-776HCL | Recombinant Human TRIM4 293 Cell Lysate | +Inquiry |
COX6B1-7329HCL | Recombinant Human COX6B1 293 Cell Lysate | +Inquiry |
HLA-DRB3-798HCL | Recombinant Human HLA-DRB3 cell lysate | +Inquiry |
GPR110-738HCL | Recombinant Human GPR110 cell lysate | +Inquiry |
HA-1844HCL | Recombinant H5N2 HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ecfT Products
Required fields are marked with *
My Review for All ecfT Products
Required fields are marked with *
0
Inquiry Basket