Recombinant Full Length Lactobacillus Helveticus Upf0397 Protein Lhv_0999 (Lhv_0999) Protein, His-Tagged
Cat.No. : | RFL18014LF |
Product Overview : | Recombinant Full Length Lactobacillus helveticus UPF0397 protein lhv_0999 (lhv_0999) Protein (A8YUY9) (1-185aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lactobacillus helveticus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-185) |
Form : | Lyophilized powder |
AA Sequence : | MKKQDLSVKNVVAMGIGSAIYVILTRFTSIPTPIPNTNIELVFPFLALFAAIYGAKVGFA VGFIGHTLSDFIMYGQTWWSWVLATGVLGLIIGLASKKLDLKNGIFGIKQILLFNIVQIF ANIIAWIVVAPIGDIIIYSEPANKVFVQGISATLSNGITILVVGTLLLKAYAGTKIKKGS LRKED |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lhv_0999 |
Synonyms | lhv_0999; UPF0397 protein lhv_0999 |
UniProt ID | A8YUY9 |
◆ Native Proteins | ||
Factor D-61H | Native Human Factor D | +Inquiry |
MPO-01H | Active Native Human MPO Protein | +Inquiry |
IgG-009H | Native Hamster Whole Molecule IgG, Biotin Conjugate | +Inquiry |
TNC-50H | Native Human Tenascin C | +Inquiry |
CST3-26152TH | Native Human CST3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAG-1464M | RAG (mouse renal adenocarcinoma) whole cell lysate | +Inquiry |
MAD2L1BP-4568HCL | Recombinant Human MAD2L1BP 293 Cell Lysate | +Inquiry |
Fetal Testis-171H | Human Fetal Testis Membrane Lysate | +Inquiry |
TMEM163-995HCL | Recombinant Human TMEM163 293 Cell Lysate | +Inquiry |
MAP3K3-4505HCL | Recombinant Human MAP3K3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lhv_0999 Products
Required fields are marked with *
My Review for All lhv_0999 Products
Required fields are marked with *
0
Inquiry Basket