Recombinant Full Length Lactate Dehydrogenase-Elevating Virus Protein X(Vpx) Protein, His-Tagged
Cat.No. : | RFL2145LF |
Product Overview : | Recombinant Full Length Lactate dehydrogenase-elevating virus Protein X(VPX) Protein (P0C781) (1-171aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | LDV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-171) |
Form : | Lyophilized powder |
AA Sequence : | MGGLEFCDQTSWYQIFIAFSLTYTPIAIYSLKVFRGTLAGIVNIFIFINCCVSFVYLMYH HSVTNTIALSLGAVIALVWGIYTLVKIVDWLVIRCRLCFLGRSYILAPPSHVDTSDGRQS LTTSLTTAFVVRKPGSTLVNGQLVPDFQRLVLGGKKAVSKGAVNLLKYVSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | VPX |
Synonyms | VPX; Protein X; Envelope protein; VpX |
UniProt ID | P0C781 |
◆ Native Proteins | ||
C4BPA-100H | Native Human C4a Anaphylatoxin (Not Recombinant) | +Inquiry |
MBP-99S | Native Swine MBP | +Inquiry |
Tryptase-61H | Native Human Mast Cell Tryptase | +Inquiry |
Lectin-8983P | Active Native Phaseolus vulgaris (red kidney bean) Lectin | +Inquiry |
Fibronectin-13R | Native Rat Fibronectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASB9-8657HCL | Recombinant Human ASB9 293 Cell Lysate | +Inquiry |
MT1H-4100HCL | Recombinant Human MT1H 293 Cell Lysate | +Inquiry |
ATP5E-8602HCL | Recombinant Human ATP5E 293 Cell Lysate | +Inquiry |
NUDT11-3653HCL | Recombinant Human NUDT11 293 Cell Lysate | +Inquiry |
BST1-2801HCL | Recombinant Human BST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VPX Products
Required fields are marked with *
My Review for All VPX Products
Required fields are marked with *
0
Inquiry Basket