Recombinant Full Length Lachancea Thermotolerans Nuclear Rim Protein 1(Nur1) Protein, His-Tagged
Cat.No. : | RFL9083LF |
Product Overview : | Recombinant Full Length Lachancea thermotolerans Nuclear rim protein 1(NUR1) Protein (C5E3S7) (1-592aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lachancea thermotolerans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-592) |
Form : | Lyophilized powder |
AA Sequence : | MTFRLSRFESPLIEDDGESRASLLGYSPENELYTDVDENRESRFRRFMSFISSSPYDMFL AINEHVESIDWDSKASTIAGPLGNFFTCSLYTARLLQDSLIRPNQQKLDKKRDSFDLSRS EILRKFEYLSQVPKSGVVVTHLNWYWKFLTFLNVALQITVGFLILINLFVAYKFLIGHFQ VYSLFYTKTSPRSKNVTKRSLSDLSFKSLEEVTNSSLWTMIRYMFVRKRLIIKDAPKGKY YYQLRKWTPGKFYTALFSAFSPISVIFLLVTEVSFKTALAVIGHQYILFLVLFKRYESRL DDEACLAKAHFEEINEKVIKPKTTIKTQDAMVDATTYGGGAAFFPSFTTTRSHIFQTHAV TGDIITERYNPETRNFEDVENTGRAKNYISQIQGVSHGQQVVSRSKAMNGATARPQFFSR QPSPSKIGTPSIILNYRTSPFSAPTTPTLKPVNGVQNGQSIFRNSPDPSKANSLNCDTSH LSRNNTLSRLRRNSVSPTKSGNYCSASGMRAIHKSNFGADSSVSYSMEAPSNELPFEEVA RRGRHPFEITASRDLPAGRSSAVSSRHSSISPFKGNTSFAGRESLDSRPPFR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NUR1 |
Synonyms | NUR1; KLTH0H15994g; Nuclear rim protein 1 |
UniProt ID | C5E3S7 |
◆ Recombinant Proteins | ||
RAB18-2103H | Recombinant Human RAB18, GST-tagged | +Inquiry |
TSKU-5976R | Recombinant Rat TSKU Protein, His (Fc)-Avi-tagged | +Inquiry |
IL12B-233B | Recombinant Bovine Interleukin 12B | +Inquiry |
PECAM1-2665H | Recombinant Human PECAM1 protein(631-700 aa), C-His-tagged | +Inquiry |
BAP1-423H | Recombinant Human BAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1856V | Active Native Vicia Villosa Lectin Protein, Biotinylated | +Inquiry |
LDH2-123H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
CTSH-190H | Active Native Human Cathepsin H | +Inquiry |
IGHG3-120H | Native Human Immunoglobulin G3 | +Inquiry |
IgG-327H | Native HORSE IgG whole molecule | +Inquiry |
◆ Cell & Tissue Lysates | ||
Thymus-523R | Rhesus monkey Thymus Lysate | +Inquiry |
DBP-7062HCL | Recombinant Human DBP 293 Cell Lysate | +Inquiry |
HOXC6-5416HCL | Recombinant Human HOXC6 293 Cell Lysate | +Inquiry |
POLR3H-3021HCL | Recombinant Human POLR3H 293 Cell Lysate | +Inquiry |
PHF19-3232HCL | Recombinant Human PHF19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NUR1 Products
Required fields are marked with *
My Review for All NUR1 Products
Required fields are marked with *
0
Inquiry Basket