Recombinant Full Length Lachancea Kluyveri Dihydroorotate Dehydrogenase (Quinone), Mitochondrial(Ura9) Protein, His-Tagged
Cat.No. : | RFL11517LF |
Product Overview : | Recombinant Full Length Lachancea kluyveri Dihydroorotate dehydrogenase (quinone), mitochondrial(URA9) Protein (Q6V3W9) (14-446aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Lachancea kluyveri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (14-446) |
Form : | Lyophilized powder |
AA Sequence : | ARSVLNSPNFFIGNRAYPLKSSVGAKAILYTAGILGGAFAGYYLFNARSAIHEYLLCPIL RLATPDAENGHRAGIFCLKWGLAPKLLFDEDDEVLHVNVFGTKMTNPIGCAAGLDKDAEA IDGIMQGGFGYMEIGSVTPLPQPGNPKPRFFRLPQDDAVINRYGFNSSGHDAVYSNLSKR VTSFLKSYFAKDNEIDKLSLYKNKLLAINLGKNKTGDEVKDYLKGVEKFQSHADVLVINV SSPNTPGLRDLQNESKLTDLLSQIVQKRNSLIQNGNVLGAKTHKPPVLVKIAPDLTEPEL ESIAVAAKKSKVDGIIVSNTTIQRPDSLVTRDEALKSQTGGLSGKPLKPFALKALKTVYK YTKDSELVLVGCGGISSGQDAIEFAKAGATFVQLYTSYAYKGPGLIAHIKDEVTEELKKE GKTWNQIIGEDSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | URA9 |
Synonyms | URA9; Dihydroorotate dehydrogenase; quinone, mitochondrial; DHOD; DHODase; DHOdehase; Dihydroorotate oxidase |
UniProt ID | Q6V3W9 |
◆ Recombinant Proteins | ||
FCER2-4733HF | Recombinant Full Length Human FCER2 Protein, GST-tagged | +Inquiry |
ADCY2-69R | Recombinant Rhesus Macaque ADCY2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NOVA2-1272H | Recombinant Human NOVA2 Protein, MYC/DDK-tagged | +Inquiry |
KBTBD4-226H | Recombinant Human KBTBD4, GST-tagged | +Inquiry |
ARRB1-29HF | Recombinant Full Length Human ARRB1 Protein | +Inquiry |
◆ Native Proteins | ||
dnt-142B | Active Native Bordetella bronchiseptica Dermonecrotic Toxin | +Inquiry |
THBS1-31515TH | Native Human THBS1 | +Inquiry |
TIMP1-92H | Native Human TIMP-1 | +Inquiry |
B. pertussis-36 | Native B. pertussis Filamentous Hemagglutinin Antigen | +Inquiry |
Hp-194R | Native Rat Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HEK293-014HCL | Human Insulin Stimulated HEK293 Whole Cell Lysate | +Inquiry |
TOB1-875HCL | Recombinant Human TOB1 293 Cell Lysate | +Inquiry |
SNX3-1591HCL | Recombinant Human SNX3 293 Cell Lysate | +Inquiry |
B18R-001VCL | Recombinant Vaccinia Virus B18R cell lysate | +Inquiry |
SUCLA2-1367HCL | Recombinant Human SUCLA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All URA9 Products
Required fields are marked with *
My Review for All URA9 Products
Required fields are marked with *
0
Inquiry Basket