Recombinant Full Length Kluyveromyces Lactis Vacuolar Membrane Protein Klla0F03465G(Klla0F03465G) Protein, His-Tagged
Cat.No. : | RFL1707KF |
Product Overview : | Recombinant Full Length Kluyveromyces lactis Vacuolar membrane protein KLLA0F03465g(KLLA0F03465g) Protein (Q6CLF2) (1-359aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Kluyveromyces lactis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-359) |
Form : | Lyophilized powder |
AA Sequence : | MDLEYYEASAVVLEERALPALTTSTEETTAKQTSTNTDDDKTTSTSTSTSTGTSSKNTKL PSLTTKTTDGSTLTTSTGTSSTETASYTTPVMELPSAKGNPNIWSSNKPTGTVFIAVGSA AGFIFLALLVWFIINTWMSYSQAKQLKKFNNMEKQFQNPFIDDIDFSSGGGYYKADEDIS TYKDTPVPTKNGGNNSFTPYKRASHSMIRLLGGSTDDGFGGGTPSSIGNTNLGSMNPLER VDAIDAANTGVRKSLYISPTMEVMNQQRRSTLFNNLNQSAVSIDTPEMMEPTRTVSPERR TYKHEKSKSSLSKLVDSTIDLTASTTLDNQKRQGRSKGHNKSSSITPSVYLDNMLEDNS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KLLA0F03465g |
Synonyms | KLLA0F03465g; Vacuolar membrane protein KLLA0F03465g |
UniProt ID | Q6CLF2 |
◆ Recombinant Proteins | ||
FOXD4-4442H | Recombinant Human FOXD4 Protein, GST-tagged | +Inquiry |
MPXV-0088 | Recombinant Monkeypox Virus A32L Protein, IMV Protein | +Inquiry |
Evi2a-983M | Recombinant Mouse Evi2a Protein, MYC/DDK-tagged | +Inquiry |
TNFRSF17-2070HAF647 | Active Recombinant Human TNFRSF17 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
RFL10173LF | Recombinant Full Length Listeria Monocytogenes Serovar 1/2A Upf0756 Membrane Protein Lmo1568(Lmo1568) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
PLP-21 | Native Mouse/Rat PLP (139-151) Protein | +Inquiry |
Collagen Type I-03R | Native Rat Collagen Type I (Atelocollagen) Protein | +Inquiry |
CRP-8059R | Native Rat Serum C-Reactive Protein | +Inquiry |
Hyaluronidase-39O | Active Native Ovine Hyaluronidase | +Inquiry |
GPT-26882TH | Native Human GPT | +Inquiry |
◆ Cell & Tissue Lysates | ||
PBK-713HCL | Recombinant Human PBK cell lysate | +Inquiry |
REPS1-1495HCL | Recombinant Human REPS1 cell lysate | +Inquiry |
CETN1-7562HCL | Recombinant Human CETN1 293 Cell Lysate | +Inquiry |
NEK7-654HCL | Recombinant Human NEK7 cell lysate | +Inquiry |
NHP2-3831HCL | Recombinant Human NHP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All KLLA0F03465g Products
Required fields are marked with *
My Review for All KLLA0F03465g Products
Required fields are marked with *
0
Inquiry Basket