Recombinant Full Length Kluyveromyces Lactis Inheritance Of Peroxisomes Protein 2(Inp2) Protein, His-Tagged
Cat.No. : | RFL24789KF |
Product Overview : | Recombinant Full Length Kluyveromyces lactis Inheritance of peroxisomes protein 2(INP2) Protein (Q6CPW5) (1-666aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Kluyveromyces lactis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-666) |
Form : | Lyophilized powder |
AA Sequence : | MDIFQAVPLHLQIPRIEIPKMASAASTPSTMSSSQTWSSSRPQVPISYQQLRKLSEWGIE ALKDTSPTVVGQDRFESQEILIDNDYRTDFLNSHEEDSRWSKQVDLIMKQLPYGDLDAFV DEFHYEIISSQLLTSSIASHHQLFTVQKSILNFNKENTLSIHNAEGKTIPTKYGQLLISG KKFYLQRTIPYMFTILTARKAFRKMLYKRHLPRSSLMSLLMIAVYLALQQEYFHAKYSKY TALLNLRQMNAALQSVDKLIYRYHLTYKELTIYKPIALTENRGLRSDEARTLTLLTDVLT CTVDQLFHKLNIASSNILPVVNAVQLTDYISIYNVDLQSLYQMIRTVESLDITQKLERLQ YMRKFFLCCLLSINYTDPLKKCEIALVLKRIFPGYHVEKTSDIERFQIISKQLYTLTQGI SSLLPVLHHYKHLLLSVYGSTIEKEDPESKEAVITQSIYRLSELQRYLMKQDKTSTELSS HLIDELNGIIQIWNIDYKHNSHEQLKPPKCSPRPSSQRVFSGGLNLDIVKTTSDIPVVVD SFPKLTSLVDVLEVDETGSDIEKEHEELVYGTENDQETASSNDSKFSRFTDDQLRHELNQ RILNLSIENKKSRENLRKQKSFELMNRKIENQKKGRPQIDCKGLFNSEESIPVLFELKQF LNRRSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | INP2 |
Synonyms | INP2; KLLA0E01694g; Inheritance of peroxisomes protein 2 |
UniProt ID | Q6CPW5 |
◆ Recombinant Proteins | ||
C5-348P | Recombinant Pig C5 Protein, His-tagged | +Inquiry |
RFL2012DF | Recombinant Full Length Dictyostelium Discoideum Nadh-Ubiquinone Oxidoreductase Chain 4L(Nad4L) Protein, His-Tagged | +Inquiry |
MCP-5323H | Recombinant HHV-5(strain AD169) MCP protein, His-tagged | +Inquiry |
PTCH1-7243M | Recombinant Mouse PTCH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNA3-5986C | Recombinant Chicken CHRNA3 | +Inquiry |
◆ Native Proteins | ||
Lectin-1817P | Active Native Peanut Lectin Protein, Rhodamine labeled | +Inquiry |
PGA-130H | Active Native Human Pepsinogen I | +Inquiry |
IgG-125G | Native Goat Immunoglobulin G | +Inquiry |
PeptideD-724E | Native Ebola virus Delta Peptide | +Inquiry |
Lectin-1863W | Active Native Wheat Germ Agglutinin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPBT-32010GR | Goat Anti-Rat SERPINA6 Polyclonal Antibody | +Inquiry |
HIST3H2BB-5512HCL | Recombinant Human HIST3H2BB 293 Cell Lysate | +Inquiry |
MCRS1-4411HCL | Recombinant Human MCRS1 293 Cell Lysate | +Inquiry |
FAM118A-6446HCL | Recombinant Human FAM118A 293 Cell Lysate | +Inquiry |
CCDC116-150HCL | Recombinant Human CCDC116 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INP2 Products
Required fields are marked with *
My Review for All INP2 Products
Required fields are marked with *
0
Inquiry Basket