Recombinant Full Length Kluyveromyces Lactis Autophagy-Related Protein 32(Atg32) Protein, His-Tagged
Cat.No. : | RFL35142KF |
Product Overview : | Recombinant Full Length Kluyveromyces lactis Autophagy-related protein 32(ATG32) Protein (Q6CYG2) (1-524aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Kluyveromyces lactis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-524) |
Form : | Lyophilized powder |
AA Sequence : | MSGSKGVWGAPPGNNNRQLYSLDAGSSGSGVSASSAQRHSILDPHDSVMDLLNGQQSCAF DSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTDSWQAIDRDEYSFLNAGNHNNYHNT SNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLSASQQHNQFLAYPLSSTGFGDQGNSETT VHQFSDGDPVKSTKTGQFSKAELGAGTGEDETIMVNLGHSWAGSFFVMPKLSLSESMKRF KILILSDGDSANSFYNRLSRYHRLMFDVGKLNEASKEEALKYTAFMIIFSDSKKVTTILN RMWKKYGDFTLIPICQKGQKQSVTEKVKTFANSNKIKLMSYPVVISDHYEIHGLLRHLHS LYVEVDSDYETDIPKKTKPRKGAKKKPAPHLAKRWWFWPISIALGVGIGCCVTFYFSKFE TSSYNSSVGVIQTADKEIDAIVDAIEGNSPSILEESSPQSISDFLGQVCKLVKDTAIQIN ELLKQFLSAHLMTSAWIQSIGKEFMQPDSQSTISKVTALDLVMF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATG32 |
Synonyms | ATG32; KLLA0A00660g; Autophagy-related protein 32 |
UniProt ID | Q6CYG2 |
◆ Native Proteins | ||
CRP-158R | Native Rabbit C-Reactive Protein | +Inquiry |
KLK3-385H | Native Human Prostate Specific Antigen (PSA), High pI Isoform (IEF) | +Inquiry |
Lectin-1826P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein | +Inquiry |
MMP1-45H | Native Human MMP-1 | +Inquiry |
SNCA-27341TH | Native Human SNCA | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIP5K1-793HCL | Recombinant Human PPIP5K1 cell lysate | +Inquiry |
Cerebral Meninges-14H | Human Cerebral Meninges Tissue Lysate | +Inquiry |
CDC20-7668HCL | Recombinant Human CDC20 293 Cell Lysate | +Inquiry |
Muscles-803G | Guinea Pig S. Muscles Membrane Lysate, Total Protein | +Inquiry |
SEMA6D-1583HCL | Recombinant Human SEMA6D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATG32 Products
Required fields are marked with *
My Review for All ATG32 Products
Required fields are marked with *
0
Inquiry Basket