Recombinant Full Length Klebsiella Pneumoniae Subsp. Pneumoniae Thiol:Disulfide Interchange Protein Dsbd(Dsbd) Protein, His-Tagged
Cat.No. : | RFL32000KF |
Product Overview : | Recombinant Full Length Klebsiella pneumoniae subsp. pneumoniae Thiol:disulfide interchange protein DsbD(dsbD) Protein (A6TH46) (20-598aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Klebsiella Pneumoniae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-598) |
Form : | Lyophilized powder |
AA Sequence : | GLFDAPGRSNFVPADQAFAFDFQQQQHDVNLSWQIKDGYYLYRQQFTFSAAGATIDEPAL PAGEWHEDEFYGKSEIFRQRLTVPVTVKEADKEATLTVTWQGCADAGFCYPPETKVIPLS AVRAASNDGQATAIEPMPSTSSRPAFNPPLPVEPRPAPELATSPAPAAVPPADTPARLPF TALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQRLSTARALLLAFIYVQGMALTYTALG LVVAAAGLQFQAALQHPYVLVGLSAVFILLALSMFGLFTLQLPSSLQTRLTLLSNKRQGG SPGGVFAMGAIAGLICSPCTTAPLSAILLYIAQSGNLWLGGGTLYLYALGMGLPLILMTV FGNRLLPKSGPWMSHVKTAFGFVILALPVFLLERILGDQWGLRLWSMLGVAFFSWAFITS LGATRPWMRLVQIILLAAALVSARPLQDWAFGAPAVEQQAHLAFTRVSSVAELDQALAQA KGQPVMLDLYADWCVACKEFEKYTFSSPDVQQALKGTVLLQVDVTKNSPQDVALLKHLQV LGLPTILFFNAEGQEQSERRVTGFMDAAAFSAHLRDWQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dsbD |
Synonyms | dsbD; KPN78578_44560; KPN_04526; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase |
UniProt ID | A6TH46 |
◆ Recombinant Proteins | ||
Arsa-654M | Recombinant Mouse Arsa Protein, MYC/DDK-tagged | +Inquiry |
ELF4-2984H | Recombinant Human ELF4 protein, His-tagged | +Inquiry |
TPSAB1-1542M | Recombinant Mouse TPSAB1 Protein (35-267 aa), His-tagged | +Inquiry |
CSTF3-1940C | Recombinant Chicken CSTF3 | +Inquiry |
LOXL2-0368H | Active Recombinant Human LOXL2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TF-62H | Native Human Apo Transferrin Protein, Tag Free | +Inquiry |
LDH3-22H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
C3a-08H | Native Human Complement C3 alpha protein | +Inquiry |
IgA-246H | Native Hamster Immunoglobulin A | +Inquiry |
HP-75C | Native Canine Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLP2-3098HCL | Recombinant Human PLP2 293 Cell Lysate | +Inquiry |
APP-3087HCL | Recombinant Human APP cell lysate | +Inquiry |
TNFSF4-857CCL | Recombinant Cynomolgus TNFSF4 cell lysate | +Inquiry |
VPS53-1916HCL | Recombinant Human VPS53 cell lysate | +Inquiry |
Pancreas-436S | Sheep Pancreas Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dsbD Products
Required fields are marked with *
My Review for All dsbD Products
Required fields are marked with *
0
Inquiry Basket