Recombinant Full Length Ixodes Scapularis Spastin(Spas) Protein, His-Tagged
Cat.No. : | RFL11137IF |
Product Overview : | Recombinant Full Length Ixodes scapularis Spastin(spas) Protein (B7PXE3) (1-648aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ixodes scapularis (Black-legged tick) (Deer tick) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-648) |
Form : | Lyophilized powder |
AA Sequence : | MASTVALLRDSSDDRENFDDGETDCVQVGRKRKLTVFFYPLLLVFWLLRWVFYQFFLVLC FVCRGFVPRRHLATAETTTTMATAEEPDANLLIRQKQHHKKAFDFISKALKYDEENEDFK EMSIDLYRKGIEELQKGIAIDFSKGQGTTWERAHRLSDKMKVNLEMARDRLDFLESMVKI EHLGDHLPWHGGVAPAQRGQRRRAWQKAAPSAPSEPGTGPSWLKMAENGPAKGGPCPTSP RLQRSNTGVTLRRQQQQQLGGVSTVSRSQTLPRNSVPCPRMSARSPSRKAGNNEAVPTPN TARRRASQPQVPPVHPRGRQPTTRGGAAHRGGPPTVSQRSLLSSRVPPLKGVDSRLAHLI LDEVVDGAPPVLFSDIAGQEVAKQALSEMVILPTDRPELFTGLRAPPKGLLLFGPPGNGK TMLAKAVAHESNSTFLNISAASLTSKYVGEGEKLVRALFAVARELQPSIIFIDEVDSLLS ERKDNEHEATRRLKTEFLVEFDGLHTGSEERVLVMGATNRPQELDDAALRRFTKRVYVTL PDHNTRVILLEKLLKKHNNPLSADKLKYLARLTEGYSGSDLTALAKDAALGPIRELNPEQ VRCVDPKKMRNISLQDFLDSLKKVRRSVTPQSLDFFDRWNREFGDITV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | spas |
Synonyms | spas; ISCW020482; Spastin |
UniProt ID | B7PXE3 |
◆ Recombinant Proteins | ||
RFL10550AF | Recombinant Full Length Arabidopsis Thaliana Casp-Like Protein At3G53850(At3G53850) Protein, His-Tagged | +Inquiry |
SLC38A7-5529R | Recombinant Rat SLC38A7 Protein | +Inquiry |
Ppp4r1-1975M | Recombinant Mouse Ppp4r1 Protein, His-tagged | +Inquiry |
EIF2S1-371H | Recombinant Human EIF2S1 Protein, MYC/DDK-tagged | +Inquiry |
Csf3-181M | Recombinant Mouse Csf3 protein, His/S-tagged | +Inquiry |
◆ Native Proteins | ||
TF-93R | Native Rat Transferrin | +Inquiry |
MYH-11R | Active Native Rabbit Myosin II Protein | +Inquiry |
C4-195H | Native Human Complement C4c | +Inquiry |
Fgb-64R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
HBsAg-ad-21H | Native Human HBsAg protein (Subtype ad) | +Inquiry |
◆ Cell & Tissue Lysates | ||
LMAN2-4718HCL | Recombinant Human LMAN2 293 Cell Lysate | +Inquiry |
FOXA3-662HCL | Recombinant Human FOXA3 cell lysate | +Inquiry |
ACPP-1625MCL | Recombinant Mouse ACPP cell lysate | +Inquiry |
RHOT2-1507HCL | Recombinant Human RHOT2 cell lysate | +Inquiry |
KIAA1967-924HCL | Recombinant Human KIAA1967 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All spas Products
Required fields are marked with *
My Review for All spas Products
Required fields are marked with *
0
Inquiry Basket