Recombinant Full Length Invertebrate Iridescent Virus 6 Putative Myristoylated Protein 118L (Iiv6-118L) Protein, His-Tagged
Cat.No. : | RFL10341IF |
Product Overview : | Recombinant Full Length Invertebrate iridescent virus 6 Putative myristoylated protein 118L (IIV6-118L) Protein (O55733) (2-515aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-515) |
Form : | Lyophilized powder |
AA Sequence : | GASISSNVTKLVTDAIVRTSNEVVQTAHATNNQSIVFDVKNTSGDVVISGNTIRQTATIN MVGLSQALNNSDNNIKLDQQIAQMAKAVISGLNLAQLADANNTVDSLIKTCIEIKNVTTQ QCMMNTSQKINVLVEGTKGNVSIVNNEISQLATSIQSCVEKAASNNKNLQDITSSIQQAA TSEAKGLSLAMIALIIVAMGLTGVGGVYAGGKIIFPAVLIGSIVSFVLYFQWTVREISSY SFVQNTLSESADCSIQKSSGESDNIGSAKSASEKCQNDNTCVAYEWQNGQAVYYKNMTIG NSCKSYYSNGAHKDTLPVIKKLIFQKGARNPVNTDVANAWLNTLDGSFWVNSDPNVLKYF GGRYGRLPYQTRYLYASGGTYVGDDVNGVGWNQQGSFGKRANRTIDWGDGPPSTITSQAE GDIWVDYHDPSLLKVYTYIAQQGGGFIWQSGQIIKGIGPIVNSNVENSKSVGFAIESKKQ WLLYLAIGLLIVGVIGMAFSSGMFSKKNNGKSKQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | IIV6-118L |
Synonyms | IIV6-118L; Putative myristoylated protein 118L |
UniProt ID | O55733 |
◆ Recombinant Proteins | ||
BMP3-922H | Recombinant Human BMP3 protein | +Inquiry |
GFER-491H | Recombinant Human GFER Protein | +Inquiry |
DPYSL4-2531H | Recombinant Human DPYSL4 Protein, MYC/DDK-tagged | +Inquiry |
STAC-2985H | Recombinant Human STAC, GST-tagged | +Inquiry |
TMEM170A-10955Z | Recombinant Zebrafish TMEM170A | +Inquiry |
◆ Native Proteins | ||
RPE-135 | Native Red algae R-Phycoerythrin protein | +Inquiry |
Lectin-1785G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, Fluorescein labeled | +Inquiry |
C6-101H | Native Human C6 Protein | +Inquiry |
LDH2-19H | Active Native Human Lactate Dehydrogenase 2 | +Inquiry |
BCHE-8054H | Native Human Serum ButyrylcholinEsterase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYSLTR2-7096HCL | Recombinant Human CYSLTR2 293 Cell Lysate | +Inquiry |
HOP62-048WCY | Human Lung Adenocarcinoma HOP62 Whole Cell Lysate | +Inquiry |
SKIL-1814HCL | Recombinant Human SKIL 293 Cell Lysate | +Inquiry |
TSPAN6-705HCL | Recombinant Human TSPAN6 293 Cell Lysate | +Inquiry |
NSA2-3689HCL | Recombinant Human NSA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IIV6-118L Products
Required fields are marked with *
My Review for All IIV6-118L Products
Required fields are marked with *
0
Inquiry Basket