Recombinant Full Length Innexin-5(Inx-5) Protein, His-Tagged
Cat.No. : | RFL30681CF |
Product Overview : | Recombinant Full Length Innexin-5(inx-5) Protein (Q23027) (1-447aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-447) |
Form : | Lyophilized powder |
AA Sequence : | MIGVLLPYVRKFQRSAESNDIADRFSYQYTSTLLGFSAIMMAASQYVGRPIQCWVPAQFT RTWEKYAETYCFIKGTYFLPGAFASEGEMSVTSPDDAVTATPQVGYYQWIPIVLVLQAFL FYLPSIIWRTFNESCELKIKELAAVSEASRKIKSNMSDDQVKATKFGRYFFKKLNFRNES PVFKETGSVVASGKFLPALYLLVKILYLANIVLQFWILTYFLETKSWMWGWQTFQDLMAG REWETTGIFPRVTMCDFSIMDLTSVHDHSIQCVIVINMLAEKVYVFFWFWLLFVGLLTVC SLAYWAVIYMLQSVGRNFIYSYLQQTPEFQTEQERGSFVPANFVDKCLTPDGVFISRLVQ QNSGDLFTSIMLGEMFSLYRAREAEKAHKKDDDSALPASAPVDLQEDDDDDTPFPPPTKA VAETLTSDDEEEETDVDSPDTTATLPR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | inx-5 |
Synonyms | inx-5; opu-5; R09F10.4; Innexin-5; Protein opu-5 |
UniProt ID | Q23027 |
◆ Recombinant Proteins | ||
HOXB3-3717HF | Recombinant Full Length Human HOXB3 Protein, GST-tagged | +Inquiry |
TMED2-9953Z | Recombinant Zebrafish TMED2 | +Inquiry |
SCO5602-1431S | Recombinant Streptomyces coelicolor A3(2) SCO5602 protein, His-tagged | +Inquiry |
FNBP1-738H | Recombinant Human FNBP1 Protein, His-tagged | +Inquiry |
CD47-152H | Recombinant Human CD47 Protein, DYKDDDDK-tagged | +Inquiry |
◆ Native Proteins | ||
C3-8391H | Native Human C3 | +Inquiry |
CAPN2-22P | Active Native Porcine CAPN2 protein | +Inquiry |
Collagen Type I-09B | Native Bovine Collagen Type I Protein | +Inquiry |
LDH4-23H | Active Native Human Lactate Dehydrogenase 4 | +Inquiry |
FGA-5H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGEF9-8728HCL | Recombinant Human ARHGEF9 293 Cell Lysate | +Inquiry |
MYRFL-8325HCL | Recombinant Human C12orf28 293 Cell Lysate | +Inquiry |
SNAPC3-1637HCL | Recombinant Human SNAPC3 293 Cell Lysate | +Inquiry |
Lung-785D | Dog Lung Membrane Lysate, Total Protein | +Inquiry |
TUBB6-646HCL | Recombinant Human TUBB6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All inx-5 Products
Required fields are marked with *
My Review for All inx-5 Products
Required fields are marked with *
0
Inquiry Basket