Recombinant Full Length Innexin-3(Inx-3) Protein, His-Tagged
Cat.No. : | RFL25713CF |
Product Overview : | Recombinant Full Length Innexin-3(inx-3) Protein (Q19746) (1-420aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-420) |
Form : | Lyophilized powder |
AA Sequence : | MLGVPFIDRWLSETFKPKTFDDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPME FKGGWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAEIGYYQWVPIVLAIQAFMFYLPS WIWSSLYKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYC YRFGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLGNETFLWGFHTFADLYAGREWQD SGVFPRVTLCDFSVRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCT IYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVT KEICEELFKKHGENLQHNRDFHHGHSTKSTSPGLEEGHHEHLYTPEKMKLMAPDYPIKHA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | inx-3 |
Synonyms | inx-3; opu-3; F22F4.2; Innexin-3; Protein opu-3 |
UniProt ID | Q19746 |
◆ Recombinant Proteins | ||
LINC02870-1789HF | Recombinant Full Length Human LINC02870 Protein, GST-tagged | +Inquiry |
EGFR-1227RAF488 | Recombinant Monkey EGFR Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
YONT-3745B | Recombinant Bacillus subtilis YONT protein, His-tagged | +Inquiry |
YESS-1367B | Recombinant Bacillus subtilis YESS protein, His-tagged | +Inquiry |
ONECUT1-4186R | Recombinant Rat ONECUT1 Protein | +Inquiry |
◆ Native Proteins | ||
CGA-1855H | Native Human, Glycoprotein Hormones, Alpha Polypeptide | +Inquiry |
FABP1-509H | Native Human FABP1 | +Inquiry |
Lectin-1757C | Active Native Canavalia ensiformis Concanavalin A Protein, Biotinylated | +Inquiry |
Thromboplastin-079B | Native Bovine Thromboplastin Protein | +Inquiry |
GS-32 | Active Native Glutamine synthetase | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPN2-6580HCL | Recombinant Human EPN2 293 Cell Lysate | +Inquiry |
RAP2C-2523HCL | Recombinant Human RAP2C 293 Cell Lysate | +Inquiry |
TAF1D-1270HCL | Recombinant Human TAF1D 293 Cell Lysate | +Inquiry |
LAMA4-967HCL | Recombinant Human LAMA4 cell lysate | +Inquiry |
Hypothalamus-426S | Sheep Hypothalamus Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All inx-3 Products
Required fields are marked with *
My Review for All inx-3 Products
Required fields are marked with *
0
Inquiry Basket